KEGG   Variovorax paradoxus S110: Vapar_2771Help
Entry
Vapar_2771        CDS       T00916                                 

Definition
(GenBank) proprionate catabolism activator, Fis family
  KO
K02688  transcriptional regulator, propionate catabolism operon regulatory protein
Organism
vap  Variovorax paradoxus S110
Brite
Transcription factors [BR:vap03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    Vapar_2771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat PrpR_N Sigma54_activ_2 HTH_8 PAS_8 PAS_4 HTH_23 AAA PAS HTH_Tnp_ISL3 AAA_5 Mg_chelatase AAA_3 HTH_28 PAS_9 PAS_7 HTH_30 HTH_29 IstB_IS21 HTH_3 HTH_17 HTH_Tnp_1 YdaS_antitoxin HTH_psq HTH_7 HTH_Tnp_1_2 ATPase AAA_16 HTH_1
Motif
Other DBs
NCBI-ProteinID: ACS19393
UniProt: C5CLY6
Position
1:complement(2917326..2919305)
Genome map
AA seq 659 aa AA seqDB search
MFQCDMPSDRPSSHFFPAPVRSGELPRLCFLSYRQIRGFAMPVVAEYTGRAEIEVVDGTF
GDALAIARDRLERGLVDAFVSAGSNASILRAGLQAPVGTIQLSGFDLLQALIKARRMSSR
VGVVMYGQTIPELDEVKDLLNIEVVQHAYQTPDDARQRFEQLRREGFEVIVGSSLVVELA
EQAGLHGLLAYSLGSVRKGFEDALELARVARLEAGRYEQLNGVLHNLQEAVLAVNRDNRV
IAVNPPMQQLLGPPHARLIGQSLEAIEPELSLQPTLDSGQVERAVVQRFAQRDWVVNRTP
IREHGEIVGAALTLYDARTIQEADTSLRIQQGRRQSAARHRFANLIGQSPAFLRAVQTAR
RFARTDLTVLIAGESGVGKELFAQSIHNESVRAGRPFVAVNCAAFPEALLESELFGYEEG
AFTGSRRGGKRGLFEAAHTGTLFLDEIGDMPLQLQTRLLRVLQEREITRLGATAAIPVDV
RVIAATHQPLNDMIAERRFRQDLFYRLNTLRLPLPPLRERREDIAPLAEAQVGRCLQRLG
TRLDPVRALAPLLPRLRAYDWPGNIRELENLGERIAVFLMQFDHLEDVRYDELRHDLPEL
FADTAASEVADDTGLSAARVAAALQAQGGNRQAAARQLGVSRSTLWRWMRERGADAPGS
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatgcgacatgcccagcgatcgcccctcctcccacttcttcccggctcccgta
cgcagcggcgagctgccacgcctgtgcttcctgagctaccggcagatccgcggattcgcg
atgccggtggtggcggaatacaccggccgcgccgagatcgaggtggtcgacggcaccttc
ggcgacgcactcgccatcgcgcgcgaccgcctcgagcgcggcctcgtcgacgccttcgtg
agcgcgggctcgaacgcgagcatcctgcgcgccggactgcaggcgccggtcggcaccatc
cagctgagcggcttcgacctgctgcaggcgctcatcaaggcgcggcgcatgtccagccgc
gtcggcgtcgtcatgtacggccagaccatccccgaactcgacgaagtgaaggacctgctc
aacatcgaggtggtgcagcacgcctaccagacgcccgacgacgcgcgccagcgcttcgag
cagctgcggcgcgagggcttcgaggtgatcgtcggctccagcctggtcgtcgagctcgcg
gagcaagccggcctgcacgggctgctcgcctactcgctgggcagcgtgcgcaagggcttc
gaggacgcgctcgaactcgcgcgcgtcgcgcggctcgaagccggccgctacgagcagctc
aacggcgtgctgcacaacctgcaggaggccgtgctggcggtgaaccgcgacaaccgcgtg
atcgcggtcaacccgccgatgcagcagctgctcggcccgccgcacgcgcggctcatcggc
cagtcgctggaggcgatcgaacccgagctgtcgctgcagcccacgctcgacagcgggcag
gtcgagcgcgccgtggtgcagcgctttgcgcagcgcgactgggtggtcaaccgcacgccg
atccgagaacacggcgagatcgtcggcgcggccctcacgctctacgacgctcgcaccatc
caggaagccgacaccagcctgcgcatccagcagggccggcgccagagcgcggcgcgccac
cgcttcgccaacctcatcggccagagcccggccttcttgcgcgcggtgcagaccgcgcgg
cgttttgcgcgtaccgacctcacggtgctgatcgccggcgagagcggcgtcggcaaggag
ctgttcgcgcagtccatccacaacgagagcgtgcgcgcgggacggcccttcgtcgccgtc
aactgcgcggcctttccggaggcgctgctggaaagcgagctgttcggctacgaggaaggc
gccttcaccggctcacgccgcggcggcaagcgcggcctgttcgaggcggcgcacacgggc
accctctttctcgacgagatcggcgacatgccgctgcaactgcagacgcgactgctgcgc
gtgttgcaggagcgcgagatcacgcggctcggcgcgacggccgccattccggtcgatgtg
cgcgtgatcgccgccacgcaccagccgctgaacgacatgattgccgagcgccgcttccgg
caagacctgttctaccgcctcaacacgctgcgcctgccgctgccgcccttgcgcgagcgg
cgcgaagacatcgcgccgctggccgaagcgcaggtcgggcgctgcctgcagcggctgggc
acgcggctggacccggtgcgcgcgctggcgccgctgctgccgcgcctgcgcgcctacgac
tggcccggcaacatccgcgagctggaaaacctcggcgagcgcatcgcggtgttcctcatg
cagttcgaccacctcgaagacgtccgctacgacgaactgcggcacgacctgccggagctt
ttcgccgatacagccgcaagcgaggtggccgacgacactgggctgagcgctgcacgcgtg
gccgcggcgctgcaggcgcaaggcggcaaccgccaggccgcggcccggcaactcggcgtg
agccgctcgacgctttggcgctggatgcgcgaacgcggcgccgatgcaccgggcagctga

DBGET integrated database retrieval system