KEGG   Variovorax paradoxus S110: Vapar_2773Help
Entry
Vapar_2773        CDS       T00916                                 

Definition
(GenBank) pyruvate carboxyltransferase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00072  Synthesis and degradation of ketone bodies
vap00280  Valine, leucine and isoleucine degradation
vap00281  Geraniol degradation
vap00650  Butanoate metabolism
vap01100  Metabolic pathways
Module
vap_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Vapar_2773
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Vapar_2773
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Vapar_2773
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    Vapar_2773
Enzymes [BR:vap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     Vapar_2773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: ACS19395
UniProt: C5CLY8
Position
1:2920651..2921592
Genome map
AA seq 313 aa AA seqDB search
MSAKEAIHITDVAPRDGLQNQAIRVGTEGKLRLIELLAEAGLRSIEAASFVSPKAVPQMA
DAGELLPQVQARFAALRTSVLVPNLKGLERAHAAGAKEIAVVLSATETMNRKNINMGLDQ
ATEVSEQTIAAARALGLRTRAYVAVAFDCPFEGETPLDEVLRLSARMHAAAADEIVIADT
IGSASPGQVKERILALRGVVPIERLAVHLHDTRGMGVANAWAALEAGVRRFDASVGGIGG
CPFAPGAAGNLATEDLVLMAERSGFATGISLAGLLAAVDFAQDELQRPLGGRAIAWLRRQ
RDKDTQDNTRRLA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgaaggaagcgatccacatcaccgacgtcgcgccgcgcgacggcttgcagaac
caggcgatccgcgtcggcaccgagggcaagctgcgcctgatcgaactgctggccgaggcc
ggcctgcgcagcatcgaggcggccagttttgtctcgccgaaggccgtgccgcagatggct
gacgccggcgaactcctgccgcaggtgcaggcgcgctttgcggcgctgcgcacctcggtg
ctggtgcccaacctcaaggggctggagcgcgcgcacgcggccggcgcgaaggagatcgcc
gtcgtgctttcggccaccgagaccatgaaccgcaagaacatcaacatgggcctggaccag
gcgaccgaagtgagcgagcagacgatcgccgccgcgcgcgcgctgggcttgcgcacgcgc
gcctacgtggccgtggccttcgactgccccttcgagggcgagacgccactcgacgaggtg
ctgcgcctgtcggcccgcatgcacgccgccgcggccgacgagatcgtcatcgccgacacc
atcggctcggcctcgccgggccaggtgaaggagcgcattttggcgttgcgcggcgtggtg
cccatcgagcgcctcgcggtgcacctgcacgacacgcgcggcatgggcgtggccaatgca
tgggcggcgctcgaggccggcgtgcgccgcttcgatgcgagcgtcggcggcatcggcggc
tgcccgttcgcgcccggcgctgcaggcaacctggcgacggaagaccttgtgctcatggcc
gagcgcagcggctttgccaccggcatctcgctcgccggcctgctcgcggcggtggacttc
gcgcaagacgaactgcaacggccgcttggcggccgcgccatcgcctggctgcgccgccag
cgcgacaaggacacacaagacaacaccaggagacttgcatga

DBGET integrated database retrieval system