KEGG   Variovorax paradoxus S110: Vapar_2774Help
Entry
Vapar_2774        CDS       T00916                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TctC
Motif
Other DBs
NCBI-ProteinID: ACS19396
UniProt: C5CMN4
Position
1:2921589..2922590
Genome map
AA seq 333 aa AA seqDB search
MNPTFNLPHPNRRQMLAGLASFASFAAVGTGGTAFAQGAKYPSKAVTLVVPYSAGGGTDI
VGRLMAQRLSELWGQSVVVDNRTGANGVIGSSTVARSAPDGHTLLLVVGSHAVNPVLMKS
LPYDTDKAFTPITNIANSPSVLVVQANGPYKTLADLLAAARKEELGCGYSEGQTRLTGEL
IRQVGNLKLTGVPYKGGAPIMVDIIGGHLPMGVTSVLTALPHVRSGALRVVGVAADRRMP
LFPDAMTFKEAGLNGVESLSWYGLFGPAGLPAPIVAQINQDLKKVAADPVVQKQMHDQGA
DITLTPPAEFRTFLASETKKWSLVAQRGGITAE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgaccttcaaccttcctcatcccaaccgccgccagatgctcgccggcctcgcg
tcattcgcctcattcgccgccgtcggcacgggcggcaccgccttcgcgcagggcgccaag
tacccgagcaaggccgtcacgctcgtggtgccgtattccgccggcggcggcaccgacatc
gtgggccgcctgatggcacagcgcctgtcggagctgtggggccagtcggtggtggtggac
aaccgcactggcgccaacggcgtgatcggctccagcaccgtggcacgctcggcgcccgat
ggccacacgctgctgctggtggtgggctcgcacgcggtcaacccggtgctgatgaagtcg
ctgccctacgacaccgacaaggccttcacgcccatcaccaacatcgcgaactcgccgtcg
gtgctggtggtgcaggccaacggtccctacaagacgctggccgacctgctggccgcggcg
cgcaaggaagagctgggctgcggctactcggaagggcagacgcgcctgaccggcgaactg
atccgccaggtcggcaacctcaagctgactggcgtgccctacaagggcggcgcgccgatc
atggtcgacatcatcggcggccacctgccgatgggcgtgaccagcgtgctgactgctctg
ccgcacgtgcgctcgggcgcgctgcgcgtggtgggcgttgcggccgatcgccgcatgccg
ctgttccccgatgcgatgaccttcaaggaagcggggttgaacggtgtcgaatcgctgagc
tggtatggcctgttcggcccggccggcctgccggccccgatcgtcgcgcagatcaaccag
gacctgaagaaggtcgcggccgaccccgtggtgcaaaagcagatgcacgaccagggcgcc
gacatcacgctcacgccaccggccgagttccgcaccttcctggcgagcgagacgaagaag
tggtcgctcgtcgcgcagcgcggcggcatcacggcggagtaa

DBGET integrated database retrieval system