KEGG   Variovorax paradoxus S110: Vapar_2776Help
Entry
Vapar_2776        CDS       T00916                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TctC Glyco_tranf_2_3 CENP-T_C DUF3551
Motif
Other DBs
NCBI-ProteinID: ACS19398
UniProt: C5CMN6
Position
1:2923495..2924493
Genome map
AA seq 332 aa AA seqDB search
MTNTYNASRRRLLALAIATTSALAIAATPAHAQQDYPNKPIRLIVPFTPGGVTDTGARVV
AERLGARLGQQVVVDNRPGASGNIGTQMVAAAPPDGYTLVLGFDGTLVINPHVFAKVPFD
TVKDFVPVSKIGDAVLVIVTHPSVPAKTLPELIAYSKSNPGGLSYGSSGTGGTPHVAAEM
LKVKTGANFVHVPYKGGGQAMTDVVGGQLPMLYTAVAGALPFIERGQVRAIAISSAQRLP
SLPDVPTVGETVSGFEASSWIGILAPAKTPTPIIDRIQRELHAVVNEPAVKERLAKLGIT
SVGNTSAEFGQQIQADLKKYADVVKAAGIKID
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacacctacaacgcttcgcgccgccgcttgctggcgctggcaatagccactacc
agtgcgctcgccatcgcagcaacgccggcgcacgctcagcaggactacccgaacaagccg
attcgcctcatcgtgcctttcacacccggtggcgtgacggacaccggcgcgcgcgtcgtg
gccgagcgcctcggggcccggctgggccagcaggtggtggtcgacaaccggcccggcgcg
tccggcaacatcggcacacagatggtcgcggccgcgccgcccgacggctacacgctggtg
ctgggcttcgacggtacgctggtcatcaacccgcacgtgttcgcgaaggtcccgttcgac
acagtgaaagacttcgtgcccgtcagcaagatcggcgatgcggtgctcgtcatcgtcacg
cacccctcggtgcccgcgaagaccttgcccgagctgatcgcatattcgaagagcaacccg
ggcggcttgtcctacggcagctctggcacgggtggcacgccccacgtcgccgctgaaatg
ctcaaggtgaagaccggcgccaacttcgtccatgtgccctacaagggcggcggccaggcc
atgaccgacgtggtcggcggccagctgccgatgctctacaccgccgtggccggcgcgctg
cccttcatcgagagaggacaggtgcgcgccatcgcgatttcgagcgcgcagcggctgcca
tcgcttcccgacgtgcccaccgtcggcgaaaccgtgtcgggcttcgaagcgagttcctgg
atcggcatcctcgcgcccgccaagacccccacgcccatcatcgaccgcattcagcgcgag
ttgcatgccgtggtgaacgagcccgcggtcaaggagcgcctcgccaagctcggcatcacg
tcggtgggcaatacgtcggcggagttcgggcaacagatccaggcggatttgaagaagtac
gcggatgtagtgaaggcggccgggatcaagattgattga

DBGET integrated database retrieval system