KEGG   Variovorax paradoxus S110: Vapar_2778Help
Entry
Vapar_2778        CDS       T00916                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-ProteinID: ACS19400
UniProt: C5CMN8
Position
1:complement(2925664..2926572)
Genome map
AA seq 302 aa AA seqDB search
MIEFRQLRQFVVVAEELNFGRAAEKLHMSQPPLSVAIRNLELQVGTLLIDRSRHHVRLTP
AGKVFLKDAQRLLTQAHAATERARRAAQGAEGSLSLSFVPSAALDLLPDIFKRFQRDYPT
VHLHVTAETTTRQVEALRRAEVDLALVVGPLQDVPDLAFVDLQAQGFVIAVPRSHALAKQ
RSVKIKALAAESFIAFPAAEGAGFVAALLSACKAAGFSPRVVQEASQMQAVLTLVAGGLG
IALVPASMRMLAMKDVAFLDVAETRAPPTYQLAFAYSRTNDNPVIHSFLAVAGKAVAHAR
ST
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagttcaggcagttgcgtcagttcgtggtggtggcggaagagctcaacttcggc
cgtgcggcggagaagctgcacatgtcccagccgccgctgagcgtggccatacgcaacctg
gaactgcaggtaggcacgctgctgatagaccgcagccggcaccatgtgcgcctgacgccg
gcaggcaaggtattcctgaaggatgcgcagcgcctgctgacacaggcccatgcggccacg
gaacgcgcgcggcgtgccgcccagggcgcggaaggctcgctcagcctgtccttcgtgccg
agtgccgcgctcgatcttctgccggacatcttcaagcggttccagcgcgactatccgacg
gtccacctgcatgtgaccgcggagaccaccacccggcaggtggaggcgctgcggcgcgcc
gaggtcgacctggccctggtggtcggcccgctgcaggacgtgccggaccttgcctttgtc
gatctccaggcacagggtttcgtcattgccgtgcctcgcagccatgccctcgcaaaacag
cgctccgtgaagatcaaggcccttgcggcagagtccttcatcgcttttccagcggccgag
ggcgcgggcttcgtggcggcgctgctcagcgcctgcaaggccgcgggcttctcgcccagg
gtcgtccaggaagcctcccagatgcaggccgtgctgacactggtcgccggcggcctgggc
atcgccctggtgccggcctccatgcgcatgctggccatgaaggacgtggctttccttgac
gtggccgaaacgcgggcaccacccacctaccagctggctttcgcctacagccgcaccaac
gacaacccagtcatccattccttcctggcagtggcaggcaaggccgtggcgcacgcgcgc
agcacctga

DBGET integrated database retrieval system