KEGG   Variovorax paradoxus S110: Vapar_2793Help
Entry
Vapar_2793        CDS       T00916                                 

Definition
(GenBank) Ankyrin
  KO
K06867  uncharacterized protein
Organism
vap  Variovorax paradoxus S110
Brite
KEGG Orthology (KO) [BR:vap00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Vapar_2793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3
Motif
Other DBs
NCBI-ProteinID: ACS19414
UniProt: C5CMQ2
Position
1:2938753..2939451
Genome map
AA seq 232 aa AA seqDB search
MMKHGIGSGLLAVALGLGASAGVSAQVPPQAAELLAYEGLHRAAWQGDLVKLKGLIASGA
NLDARDARGRTPLHVATHARQREAVKLLAKAGANLDLLDDDRYDAVTIAAVADDAATLAL
LLSLGAKAGQVTSRYDGTALIAAAHLGHDEVVRQLIAAGAPLDHVNNLHWTAVIESIVLG
DGGPRHQRTLAALVDAGASLALADRQGNTPLQLARARGYTAMVKLLEAPRAR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcacggcatcgggtccgggctgctggcggttgcgcttggactgggcgcatcg
gccggcgtgtcggcccaggtgccgccgcaggctgccgagctgctggcctatgaaggactg
caccgggcggcctggcagggcgacctggtcaagctgaagggcttgatcgcctcgggcgcc
aatctggatgcgcgcgatgcgcggggccgcacgcccttgcacgtcgccacccatgcacgg
cagcgcgaggcggtgaagctgcttgccaaggccggcgcgaacctcgacctgctcgacgac
gaccgctacgacgccgtcaccatcgccgcggtggccgacgatgccgcgacgcttgcgctg
ctgctgtcgctcggcgcgaaggccgggcaggtgaccagccgctacgacggcaccgcgctc
attgccgcggcgcacctgggccatgacgaagtggtgcgccagctgatcgcggccggcgcg
ccgctcgaccacgtcaacaacctgcattggaccgcggtgatcgaatcgatcgtgctgggc
gacggcggcccgcgccaccagcgcacgctggccgcgctggtcgacgccggcgccagcctt
gcgctggccgaccggcagggcaacacgccgctgcagctggcgcgggcccgcggctacacg
gccatggtgaagctgctggaagcgccgcgcgcaagatag

DBGET integrated database retrieval system