KEGG   Variovorax paradoxus S110: Vapar_2794Help
Entry
Vapar_2794        CDS       T00916                                 

Definition
(GenBank) FMN-binding negative transcriptional regulator
  KO
K07734  transcriptional regulator
Organism
vap  Variovorax paradoxus S110
Brite
Transcription factors [BR:vap03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Vapar_2794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_bind_2 Putative_PNPOx
Motif
Other DBs
NCBI-ProteinID: ACS19415
UniProt: C5CMQ3
Position
1:2939497..2940141
Genome map
AA seq 214 aa AA seqDB search
MYMPPQFNAKDPAIALELMRAHPFASLISSDDEGLPYVTHLPLVAEQQEGGQLVLLGHCA
KPNPHWRHLQARPQAVATFLGPHAYLSPSVYPDLARVPTWNYLVVHCTVEARLIEEPVAK
DALLKKLIGEHEPGYAQQWRDLGEEFQLKMLAGIVGFELRVSALQCKVKLNQHRRESHAA
MHAVYSAGTPDEKALAVWMERLGMTAEAPVAEGS
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtacatgccgccgcaattcaacgccaaggacccggccatcgcgctggagctgatgcgt
gcacatcccttcgccagcctgatctcgagcgacgacgagggcctgccttacgtcacgcac
ctgccgctggtggccgagcagcaggagggcggccagctggtgctgctgggccactgcgcc
aagcccaatccgcactggcgccatctgcaggcgcggccgcaggcggtggccacctttctc
ggtccgcatgcctacctgtcgccctcggtctatccggacctcgcgcgcgtgccgacctgg
aactacctggtggtgcactgcacggtcgaggcccggctgatcgaggagcccgtggccaag
gacgcgctgctcaagaagctcatcggcgagcacgagcccggctatgcgcagcaatggcgc
gacctgggcgaggagttccagctcaagatgctggccggcatcgtcgggttcgagctgcgc
gtgagcgcactgcaatgcaaggtcaagctgaaccagcaccggcgcgaatcgcacgctgcg
atgcatgccgtctacagcgccggcacgcccgacgagaaggcgctggccgtgtggatggaa
cgcctgggcatgacggccgaggcaccggtggcggaaggaagctga

DBGET integrated database retrieval system