KEGG   Variovorax paradoxus S110: Vapar_2922Help
Entry
Vapar_2922        CDS       T00916                                 

Definition
(GenBank) acyl-CoA dehydrogenase domain protein
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00071  Fatty acid degradation
vap00280  Valine, leucine and isoleucine degradation
vap00410  beta-Alanine metabolism
vap00640  Propanoate metabolism
vap00650  Butanoate metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01130  Biosynthesis of antibiotics
vap01200  Carbon metabolism
vap01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Vapar_2922
   00650 Butanoate metabolism
    Vapar_2922
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Vapar_2922
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Vapar_2922
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Vapar_2922
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     Vapar_2922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_C Acyl-CoA_dh_1 Acyl-CoA_dh_M AcylCoA_DH_N Acyl-CoA_dh_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-ProteinID: ACS19542
UniProt: C5CNR5
Position
1:complement(3070719..3072572)
Genome map
AA seq 617 aa AA seqDB search
MSLRPTLDFLLYDWLDAESLSQRERFSDHSRETFDAVLDTCERIAREKYAPANRIVDTQE
PHFDGEKVVLPQATHDAHKAFVESGMMSAAQDYDIGGMQLPYTLQAAANSFFAMASVSIG
SNMLTSGNANLLMVHGTEMQKEVFAKNEFSGRWAGTMCLSEPQAGSSLSDVATRAVPDGD
GYQGDPLGPRYRLTGNKMWISAGDHELTENIVHIVLAKIPDANGKLVPGTRGISLFIVPK
RMVNTQGELTGERNDVALAGLNHKLGWRGTTNTLLNFGEGKYPVGGKAGAVGYLVGEPGK
GLHCMFHMMNEARIGVGTAATMLGMAGYYASLDYAKTRPQGRLVKKAEQPGTAVAKDSAS
PQVRIIEHADVRRMLLAQKAYCEGALALELYCARLVDEQKTGDAQAADDARLLLEVLTPI
AKSWPSEWCLEANSLAIQVHGGYGYTRDFPVEQYWRDNRLNMIHEGTHGIQAADLLGRKV
LMEKGRGLQLLGGRIAETIGHAAKVPALAAHARALDAAWQRIVNATQAAWSTGDPADALA
NAVPYMQAFGHTVLAWIWLDVARRALEIDADKARAVTAGKIGATDYFFHYELPKIGAWLN
VVESRDPTCTALPEDAF
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcgtcccaccctcgacttcctgctttacgactggctcgacgcggaatcgctg
agccagcgcgagcgtttctcggaccactcgcgcgagaccttcgatgcggtgctcgacacc
tgcgaacgcattgcgcgcgaaaagtacgcgccggccaatcgcatcgtcgacacgcaggag
ccgcatttcgacggcgagaaggtggtgctgccgcaggccacgcatgacgcgcacaaggcc
tttgtcgagtcgggaatgatgagcgcggcgcaggactacgacatcggcggcatgcagctg
ccctacacgctgcaggccgcggccaacagcttctttgcgatggcgtcggtcagcatcggc
tcgaacatgctcacgagcggcaacgccaacctgctgatggtgcacggcaccgagatgcag
aaggaagtgttcgccaagaacgagttctcgggccgctgggccggcaccatgtgcctgtcc
gagccgcaggccggctcctcgctgagcgacgtggccacgcgcgccgtgcccgatggcgac
ggctaccagggcgatccgctcgggccgcgctatcggctcacgggcaacaagatgtggata
tcggcgggcgaccatgagctcaccgagaacatcgtgcacatcgtgctcgcaaagattccg
gatgcgaatggcaagctggtgccgggcacgcgtggcatctctctgttcattgtgcccaag
cgcatggtgaacacccaaggcgagttgaccggcgagcgcaacgacgtggcgctcgcaggc
ctcaaccacaagctcggctggcgcggcaccaccaacacgctgctgaacttcggcgagggc
aagtacccggtcggcggcaaggcgggtgcggtgggctacctggtcggcgagcccggcaag
ggcctgcactgcatgttccacatgatgaacgaggcgcgcatcggcgtcggcacggccgcc
accatgctgggcatggccggctattacgcctcgctcgactatgcgaagacgcggccgcag
ggccggctcgtgaagaaggcggagcagcccggcacggcggtcgccaaggactcggccagc
ccgcaggtgcgcatcatcgagcatgccgacgtgcgccgcatgctgcttgcgcagaaagcg
tactgcgaaggcgcgctggcgctggagctgtactgcgcgcggctggtcgacgagcagaag
accggcgacgcgcaggccgcggacgacgcgcgcctcttgctggaggtgctcacgcccatt
gccaagagctggcccagcgagtggtgcctggaagccaattcgctggccatccaggtgcat
ggcggctacggctacacgcgcgattttccggtggagcagtactggcgcgacaaccgcctg
aacatgatccacgagggcacgcacggcatccaggcagccgacctgctgggccgcaaggtg
ctgatggaaaagggccgcggcctgcagctgctgggcgggcgcatcgccgagaccatcggc
cacgccgccaaggtgcccgcgctcgcggcgcatgccagggcgctggacgccgcatggcag
cgcatcgtcaacgccacccaggcggcctggtccaccggcgatccggccgacgcgctggcc
aacgccgtgccctacatgcaggccttcggccacaccgtgctggcctggatctggctggac
gtggcgcggcgggcgctggagatcgatgcggacaaggcgagggcggtaacagctggcaag
ataggcgccacggactacttcttccactacgagctgccgaaaatcggtgcctggctcaac
gtggtcgagagccgcgaccctacctgtaccgcattgcccgaggacgctttttga

DBGET integrated database retrieval system