KEGG   Variovorax paradoxus S110: Vapar_4081Help
Entry
Vapar_4081        CDS       T00916                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00450  Selenocompound metabolism
vap00970  Aminoacyl-tRNA biosynthesis
vap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Vapar_4081
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Vapar_4081
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vap01007]
    Vapar_4081
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vap03016]
    Vapar_4081
Enzymes [BR:vap01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Vapar_4081
Amino acid related enzymes [BR:vap01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Vapar_4081
Transfer RNA biogenesis [BR:vap03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Vapar_4081
 Prokaryotic type
   Other AARSs
    Vapar_4081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1f tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ACS20694
UniProt: C5CWT7
Position
1:4325470..4327584
Genome map
AA seq 704 aa AA seqDB search
MSAPRKLFVTTALPYANGKFHIGHMMEYIQADIWVRNQRMNGAEVNFVCADDAHGAAITI
AADKAGVTPQAFVAEIAAGRKPYLDGYYISFDNWHSTDAPENHQLAQDIYRDLRANGLIE
TKSVEQFYDPEKGMFLADRFIKGECPNCHAKDQYGDNCEVCGAVYAPTELINPYSALSGA
KPELRSSDHFFFKLSDPRCEAYLKEWTAAAGHVQSEVQNKIREWLYKDDEGKGGLGDWDI
SRDAPYFGIEIPDAPGKYFYVWLDAPVGYLASLKNLLDKRCIELGGDGISYTEYMADPDL
EQVHFIGKDIITFHTLFWPAMLHFSGRKAPDAVYVHGHLTVSGEKMSKSRGTGIDPLRYL
SIGLDPEWLRYYIAAKLNGRNEDIDFNPEDFVARVNSDLVGKYINIASRAAGFIGKRFGG
KLGEVSADGDALLFALRDAAPQLHSLYDGRDYARALREVMALADKVNEYVDQNKPWELAK
KEGQEARLHDVCTVCIEAFRLLTLYLKPVLPALAANVEAFLRIEPLAWADAAQSLPAGHA
IGEYKHLMQRADAKMVDKLFDAPEPAPPAAAAAEESLPGGEAIAPAITIDDFAKIDLRIA
KIVACEKVEGSTKLLRLTLDAGEGTDPQGSPVLRNVFSGIASAYQPEQLVGKLTVLVANL
APRKMKFGISEGMVLAASHGDEKAHPGIHVLEPWPGATPGMRVR
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccccgcgcaagctcttcgtcaccaccgccctgccgtatgccaacggcaagttc
catatcggccacatgatggaatacatccaggccgacatctgggtgcggaaccagcgaatg
aatggcgccgaggtcaacttcgtctgcgccgacgacgcgcacggcgcggccatcaccatc
gcggccgacaaggccggcgtgacgccgcaggccttcgtggccgagatcgccgcgggccgc
aagccctacctggacggctactacatctcgttcgacaactggcactcgaccgacgcgccc
gagaaccaccagctcgcgcaggacatctaccgcgacctgcgcgccaacggcctgatcgaa
accaagagcgtcgagcagttctacgaccccgaaaagggcatgttcctggccgaccgcttc
atcaagggcgagtgccccaactgccacgccaaggaccagtacggcgacaactgcgaggtg
tgcggcgcggtctacgcgcccaccgagctgatcaatccctactcggccctgtccggcgcc
aagcccgagctgcgcagctccgaccacttcttcttcaagctctcggacccgcgctgcgag
gcctacctgaaggaatggaccgccgctgccggccacgtgcagtccgaagtgcagaacaag
atccgcgagtggctctacaaggacgacgaaggcaagggcggcctcggcgactgggacatc
agccgcgatgcgccctacttcggcatcgagattcccgatgcgccgggcaagtacttctac
gtgtggctcgatgcgcccgtgggctatctggcctcgctgaagaacctgctcgacaagcgc
tgcatcgagctgggcggcgacggcatctcgtacaccgagtacatggccgaccccgacctg
gagcaggtgcacttcatcggcaaggacatcatcaccttccacacgctcttctggcccgcg
atgctgcacttcagcggccgcaaggcgcccgacgcggtgtacgtgcacggccacctgacg
gtcagcggcgagaagatgagcaagagccgcggcaccggcatcgacccgctgcggtacctg
tcgatcggcctggaccccgaatggctgcgctactacatcgcggccaagctcaacggccgc
aacgaggacatcgacttcaaccctgaagacttcgtcgcgcgcgtcaacagcgacctcgtg
ggcaagtacatcaacatcgcgagccgcgcggcgggcttcatcggcaagcgcttcggcggc
aagctgggcgaggtgtcagccgacggcgacgcactgctgttcgcgctgcgcgatgcggcg
ccgcagctgcattcgctctacgacggccgcgactacgcccgcgcgctgcgcgaggtgatg
gcgctggccgacaaggtgaacgagtacgtcgaccagaacaagccctgggaactggccaag
aaggaaggccaggaagcgcggctgcacgacgtgtgcaccgtgtgcatcgaggccttccgc
ctgctcacgctgtacctgaagccggtgctgccggcgctcgccgccaatgtcgaagccttc
ctccggatcgagccgctcgcgtgggccgatgccgcgcagagcctgccggccggccacgcc
atcggcgaatacaagcacctgatgcagcgcgccgacgccaagatggtcgacaagctgttc
gacgcgcccgagcccgcaccaccggccgccgccgcggcagaagaatcgctgccgggcggc
gaagccatcgcgcccgccatcaccatcgacgacttcgccaagatcgacctgcgcatcgca
aagatcgtggcctgcgagaaggtcgagggctcgaccaagctgctgcgcctgacgctcgac
gcgggcgagggcaccgacccgcaggggagtcctgttctgcgcaacgtgttcagcggcatc
gcctccgcttaccagcccgagcagctcgtgggcaagctcacggtgctggtcgccaacctc
gcgccgcgcaagatgaagttcggcatcagcgaaggcatggtgctggccgcaagccatggc
gacgaaaaagcccaccccggcatccacgtgctcgagccctggccgggcgcgacgccgggc
atgcgcgttcgctga

DBGET integrated database retrieval system