KEGG   Variovorax paradoxus S110: Vapar_4235Help
Entry
Vapar_4235        CDS       T00916                                 

Definition
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00260  Glycine, serine and threonine metabolism
vap00750  Vitamin B6 metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01230  Biosynthesis of amino acids
Module
vap_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Vapar_4235
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Vapar_4235
Enzymes [BR:vap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Vapar_4235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACS20848
UniProt: C5CXZ2
Position
1:complement(4477169..4478368)
Genome map
AA seq 399 aa AA seqDB search
MPAPVIHFKLASASEPSGTARPRPPRPLKNPRLQGFRCLRCDAPYPLTLANDGCPACRGM
GVHVGLHASYLPGGDSPVPMPYAPGFTLGEGGTPLLDMPELAHEFGVARLALKDESCNPT
GSHKDRMTAVGVAQALDFGAHTLVLASSGNAAVSAAHYAWAAGLGCEVATYEGLPAAYAR
QLDALGARRHAFADNAGRWAFVRERSQHPGYFALTNYRLPALGSAPLAIEGYKPIALECL
AEGGLPDHLVIPTARGDLAWGIYAGFRDLLAAGRISRLPRLWLVEPFARLSRVLAGGALD
GAYPGHTAQFSTAGSTVTFLQWQAAVASGGGAVVVGDEQARAARQKLTAAGVSAELCAAA
GLDALRQLREGNAIAADAHVVLMLTANASRDPSWPDRAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgcccgtcatccacttcaagctcgcctcggcttccgagccgtccggcaccgcg
cgaccccgtccgccgcgcccgctgaaaaacccccgcctgcagggttttcggtgcctgcgc
tgcgatgccccctatccgctgacgctggcgaacgacggctgcccggcctgccgcggcatg
ggcgtccatgtcgggctgcacgcgagctacctgccgggcggcgacagccccgtgcccatg
ccctacgcgccgggcttcacgctgggcgagggcggcacgccgctgctcgacatgccggaa
ttggcgcacgaattcggcgtggcgcggctcgcgctcaaggacgaatcgtgcaaccccacg
ggctcccacaaggaccgcatgaccgcggtgggcgtggcccaggcgctggacttcggcgcc
cacacgctggtgctggcctcatcgggcaatgccgcggtctcggcggcgcactatgcatgg
gctgcggggctgggctgcgaagtggccacttacgaaggcctgcccgccgcctacgcgcgg
cagctcgatgcgctgggcgcgcggcgccacgcctttgccgacaacgccggccgctgggcc
ttcgtgcgcgagcgctcgcagcatccgggctatttcgcgctgaccaattaccgcctgccc
gccctgggcagcgcgccgctcgcgatcgagggctacaagcccatcgccctggagtgcctg
gccgagggcggcctgcccgaccacctcgtgattcccacggcgcgcggcgacctggcctgg
ggcatctacgcgggctttcgagacctgctggccgccgggcgcatttcgcggctgccgcgg
ctctggctggtggagccttttgcgcgcctctcgcgcgtgctggccggcggggcgctcgac
ggcgcatatcccggccacaccgcgcagttttccaccgccggctccaccgtgaccttcctg
cagtggcaggcggccgtcgcctcgggcggcggcgcggtggtggtgggcgacgagcaggcc
cgcgcggcccggcaaaagctcacggcggccggcgtgagcgccgaactgtgcgcggcggcc
gggctcgacgcgctgcgccagctgcgcgagggcaacgcgattgccgccgacgcccacgtg
gtgctgatgctcaccgccaacgcctcgcgcgacccgagctggcccgaccgggccgcctga

DBGET integrated database retrieval system