KEGG   Variovorax paradoxus S110: Vapar_4336Help
Entry
Vapar_4336        CDS       T00916                                 

Definition
(GenBank) ATP-NAD/AcoX kinase
  KO
K00858  NAD+ kinase [EC:2.7.1.23]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00760  Nicotinate and nicotinamide metabolism
vap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Vapar_4336
Enzymes [BR:vap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     Vapar_4336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACS20947
UniProt: C5CYY6
Position
1:4581039..4581950
Genome map
AA seq 303 aa AA seqDB search
MTSRFRHVALIGKYQASGARAQADARDGVMEDIGAFLESQGCEVFVEKSAAEEADADASV
GGRYQPLTVEEIGQRCDLGLVVGGDGTMLGIGRQLACYGIPLIGINRGRLGFITDIPLDN
YQATLIPMLAGEYEEDHRSLMHAQVMRDGASVFDALAMNDVVVNRGATSGMVELRVSVGR
HFVANQRADGLIIASPTGSTAYALSAGGPLLHPAVPGWVLVPIAPHTLSNRPVLLPDADE
IVIELVAGRDASANFDMQSLASLAIGDRVVVRRSDFRVRFLHPRGWSYFDTLRKKLHWNE
GGS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacttcccgctttcgtcacgtcgcgctgatcggcaaataccaggcttcaggcgcccgg
gcgcaggccgatgcccgcgacggcgtgatggaagatatcggcgccttcctggaatcgcaa
gggtgcgaggtcttcgtcgaaaaatcggcggccgaggaggccgatgcggacgccagcgtc
ggcggccgctaccagccgctgaccgtcgaggaaatcggccagcgctgcgatctgggcctg
gtggtgggaggcgacggcaccatgctgggcatcggccggcagctcgcctgctacggcatt
ccgctgatcggcatcaaccgcggccggctcggattcatcaccgacattccgctggacaac
taccaggccacgctgattcccatgctggccggcgaatacgaggaagaccaccgcagcctc
atgcatgcgcaggtgatgcgcgacggcgcctcggtcttcgatgcgctggcaatgaacgac
gtggtggtcaaccgcggcgccacctcgggcatggtcgagctgcgcgtttcggtgggccgg
catttcgtggccaaccagcgcgccgacggcctgatcatcgcttcgcccacgggttcgacg
gcctatgcgctctcggccggcgggccgctgctgcatccggcggtgccgggctgggtgctg
gtgcccattgcgccgcacacgctgtcgaaccgccccgtgctgctgcccgacgccgacgag
atcgtgatcgaactggtggcggggcgcgacgccagcgccaatttcgacatgcagtcgctg
gcctcgctcgcgatcggcgatcgcgtggtggtgcgccgctccgacttccgcgtgcgcttc
ctgcacccgcgcggctggagctatttcgacacgctgcgcaagaaacttcactggaacgaa
gggggctcctga

DBGET integrated database retrieval system