KEGG   Variovorax paradoxus S110: Vapar_4482Help
Entry
Vapar_4482        CDS       T00916                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00020  Citrate cycle (TCA cycle)
vap00640  Propanoate metabolism
vap00660  C5-Branched dibasic acid metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01130  Biosynthesis of antibiotics
vap01200  Carbon metabolism
Module
vap_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vap_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Vapar_4482
   00640 Propanoate metabolism
    Vapar_4482
   00660 C5-Branched dibasic acid metabolism
    Vapar_4482
Enzymes [BR:vap01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Vapar_4482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Succ_CoA_lig ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ACS21093
UniProt: C5CK42
Position
1:complement(4731311..4732480)
Genome map
AA seq 389 aa AA seqDB search
MNIHEYQGKDVLRKYGVPTPRGYACFSPDEAADAAAQLGGRAWVVKAQIHAGGRGKGGGV
RLAWSAAEVRRHADELLGMTLRTHQTGPQGRLVKRLLVEESVEIEKEFYLGMAVDRESRR
VALMASSEGGMDIEDVAARTPEKIRKLFVDPSTGVKAVEADGLARDIGFSGKLLPQVRTL
VQNLYQAFDACDASLAEINPLALTRDGRVLALDAKFNFDPNALFRQPEIAAMRDLDEEDP
AEVEASKFDLSYIALEGDIGCLVNGAGLAMATMDAIKLYGGSPANFLDVGGGATAEKVTE
AFKLMLRNPNLRAILVNIFGGIMKCDVIARGVVAAAREVQLAVPLVVRMKGTNESLGKTI
LGQSGLRIISADDMAEAAGLVVAAARRGG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgaataccagggcaaggacgtattgcgcaaatacggcgttcccacgccg
cgtggatatgcctgcttttcgcccgacgaggcggccgatgcggccgcgcagcttggcggc
agggcctgggtggtcaaggcgcagatccatgcgggcggccgcggcaagggcggcggcgtg
cggctggcctggtcggcggccgaagtgcggcgccatgccgacgagctgcttggcatgacc
ctgcgaacgcaccagacgggcccgcaaggccggctcgtgaagcggctgctggtggaggag
agcgtcgagatcgaaaaggagttctacctcggcatggcggtcgaccgcgaatcgcgccgc
gtggccctgatggcgtcgagcgaaggcggcatggacatcgaggacgtggcggcgcgcacg
ccggaaaaaatccgcaagctcttcgtcgatccgtccaccggcgtgaaggcagtcgaggcc
gatggcctggcgcgcgacatcggcttttccggaaagctgctgccgcaggtgcgcacgctg
gtgcagaacctctaccaggccttcgacgcctgcgacgcatcgctggccgagatcaacccg
ctggcgctcacgcgcgacggccgcgtgctggcgctggatgccaagttcaacttcgatccg
aacgcgctgttccgccagcccgagatcgccgcgatgcgcgatctcgacgaggaagacccg
gccgaggtcgaggcctcgaagttcgatctttcctacattgcactggaaggcgacatcggc
tgcctggtgaacggcgcgggcctggcgatggccacgatggacgcgatcaagctctacggc
ggatcgccggccaatttcctggacgtgggcggtggcgccacggccgagaaggtgaccgaa
gccttcaagctgatgctgcgcaacccgaacctgcgcgcgatcctggtcaacatcttcggc
ggcatcatgaagtgcgacgtgatcgcgcgcggcgtggtggctgccgcgcgcgaggtccag
ctggcggtgccgctggtggtgcgcatgaagggcaccaacgagagcctgggcaagaccatc
ctcgggcagtcgggccttcggatcatcagtgcggacgacatggcggaggcggcggggctg
gtggtggctgctgcgcggcggggaggctag

DBGET integrated database retrieval system