KEGG   Variovorax paradoxus S110: Vapar_4732Help
Entry
Vapar_4732        CDS       T00916                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00071  Fatty acid degradation
vap00072  Synthesis and degradation of ketone bodies
vap00280  Valine, leucine and isoleucine degradation
vap00310  Lysine degradation
vap00362  Benzoate degradation
vap00380  Tryptophan metabolism
vap00620  Pyruvate metabolism
vap00630  Glyoxylate and dicarboxylate metabolism
vap00640  Propanoate metabolism
vap00650  Butanoate metabolism
vap00900  Terpenoid backbone biosynthesis
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01120  Microbial metabolism in diverse environments
vap01130  Biosynthesis of antibiotics
vap01200  Carbon metabolism
vap01212  Fatty acid metabolism
vap02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Vapar_4732
   00630 Glyoxylate and dicarboxylate metabolism
    Vapar_4732
   00640 Propanoate metabolism
    Vapar_4732
   00650 Butanoate metabolism
    Vapar_4732
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Vapar_4732
   00072 Synthesis and degradation of ketone bodies
    Vapar_4732
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Vapar_4732
   00310 Lysine degradation
    Vapar_4732
   00380 Tryptophan metabolism
    Vapar_4732
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Vapar_4732
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Vapar_4732
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Vapar_4732
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vap04147]
    Vapar_4732
Enzymes [BR:vap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Vapar_4732
Exosome [BR:vap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Vapar_4732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C PdxJ ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACS21337
UniProt: C5CM78
Position
1:complement(5028927..5030111)
Genome map
AA seq 394 aa AA seqDB search
MPESIVIVGAARTPMGSFQGDFSSLAAHDLGGAAIKAAVERAGIAPDSVGEVLFGNCLMA
GQGQAPARQAAYKGGLPDSAGAVTLSKMCGSAMKAAMLTHDLLLAGTHEVMVAGGMESMT
NAPYLMLKGRGGYRMGHDRIFDHMMLDGLEDAYQPGRSMGTFGEDCAAKYKFTREQQDAF
AIASVQRAKAATESGAFKDEITPITVKGRGGDTVISIDEGPGKVKLDKIATLKPAFKKEN
GTITAASSSSINDGAAALVMMTESHAKKIGARPIARIVGHATHAQQPEWFSTAPVGAVAK
LFKKTGWTVKDVDLWEVNEAFAVVPMALMHELDVSHEIVNVNGGACALGHPIGASGARIM
VTLIHALKARGKKRGVATLCIGGGEGTAVALELL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaatccatcgtcatcgtcggcgccgcccgcacccccatggggagcttccagggc
gacttctcttcccttgccgcgcacgacctcggcggcgccgccatcaaggccgccgtcgag
cgcgccggcatcgcgcccgacagcgtgggcgaagtgctgttcggcaattgcctgatggcc
ggccagggccaggcgccggcgcgccaggcggcctacaagggcggcctgcccgacagcgcg
ggcgcggtcacgctcagcaagatgtgcggctcggccatgaaggccgcgatgctcacgcac
gacctgctgctggccggcacgcacgaggtgatggtggctggcggcatggagagcatgacc
aacgcgccctacctcatgctcaagggccgcggcggctaccgcatgggccacgaccgcatc
ttcgaccacatgatgctcgacggcctggaagacgcctaccagccgggccgctcgatgggc
accttcggcgaggactgcgccgccaagtacaagttcacgcgcgagcagcaagatgcgttt
gccattgccagcgtgcagcgcgccaaggccgccaccgaatccggcgcgttcaaggacgag
atcacgcccatcaccgtgaagggccgcggcggcgacaccgtcatttccatcgacgaaggc
ccgggcaaggtcaagctcgacaagatcgccacgctcaagcccgcgttcaagaaggaaaac
ggcaccatcaccgccgcatcgagctcgtcgatcaacgacggcgccgccgcgctggtgatg
atgaccgagtcgcacgccaagaagatcggcgccaggccgatcgcccgcatcgtcggccat
gccacgcatgcgcagcagcccgagtggttctccaccgcgccggtcggcgccgtggccaag
ctgttcaagaagaccggctggaccgtcaaggacgtggacctgtgggaagtgaacgaggct
ttcgcggtggtgccgatggcgctgatgcacgagctcgacgtgtcgcacgagatcgtcaac
gtgaacggcggcgcctgcgcgctgggccacccgatcggcgccagcggcgcgcgcatcatg
gtcacgctgatccatgcgctgaaggcgcgcggcaagaagcgcggcgtggccacgctgtgc
atcggcgggggcgaaggcaccgccgtggcactcgagttgctttaa

DBGET integrated database retrieval system