KEGG   Variovorax paradoxus S110: Vapar_4803Help
Entry
Vapar_4803        CDS       T00916                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00220  Arginine biosynthesis
vap00330  Arginine and proline metabolism
vap01100  Metabolic pathways
vap01110  Biosynthesis of secondary metabolites
vap01130  Biosynthesis of antibiotics
vap01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Vapar_4803
   00330 Arginine and proline metabolism
    Vapar_4803
Enzymes [BR:vap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Vapar_4803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACS21408
UniProt: C5CN45
Position
1:5121820..5122743
Genome map
AA seq 307 aa AA seqDB search
MSNDNGTTLELIGAPTDVGASVRGAGMGPDALRVAGLPEALARQGFTVIDRGNLAGPATP
WTAPANGLRHLDEVIAWNRSVYAAVDTALGTGHVPLMMGGDHCLAIGSISAVAWHVRKRG
KKLRVLWLDAHSDVNTETTSPSGNLHGMPVSCLLGHGPAALTGWSGERAALEHDAIRFIG
IRSVDADEKDAIRTLGLHVFDMRHIDEHGMRTTMTEALQDVDEDTHLHVSFDLDCLDPNI
APGVGTGVRGGPTYREMQLCMEMVADTRRLGSVDVVELNPALDVRNQTAEVAVELIESLF
GKSTLVR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgacaacggcaccaccctcgaactgatcggcgcgcccaccgacgtcggtgcc
agcgtgcgcggcgccggcatgggccccgatgcgctgcgcgtggccgggctgccggaggcg
ctcgcgcggcagggcttcaccgtgatcgaccgcggcaacctcgcgggccccgccaccccg
tggaccgcgccggccaacggcctgcgccacctcgacgaggtgattgcctggaaccgctcc
gtctacgccgccgtcgacaccgccctgggcaccggccacgtgccgctcatgatgggcggc
gaccactgcctggccatcggctcgatcagcgccgtggcctggcatgtgcgcaagcgcggc
aagaagctgcgcgtgctgtggctcgatgcgcactccgacgtcaacaccgaaaccaccagc
ccgagcggcaacctgcacggcatgcccgtgtcctgcctgctgggccacgggcccgcggcg
ctcaccggctggagcggcgagcgcgcggcgctggagcacgatgccatccgcttcatcggc
atccgcagcgtcgacgcggacgagaaggacgccatccgcacactcggcctgcatgtgttc
gacatgcgccacatcgacgagcacggcatgcgcaccaccatgaccgaggcgctgcaggac
gtggacgaggatacccacctgcacgtgagcttcgacctggattgcctcgatccgaacatc
gcacccggcgtgggcaccggcgtgcgcggcggcccgacctaccgcgagatgcagctgtgc
atggaaatggtcgccgacacccgccgcctcggctcggtcgacgtggtggagctgaacccc
gcgctcgacgtgcgcaaccagaccgccgaagtggcggtggagctgatcgagagcctgttc
ggaaagtcgacgctggtgcgctga

DBGET integrated database retrieval system