KEGG   Variovorax paradoxus S110: Vapar_5165Help
Entry
Vapar_5165        CDS       T00916                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
vap  Variovorax paradoxus S110
Pathway
vap00480  Glutathione metabolism
vap00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Vapar_5165
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Vapar_5165
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Vapar_5165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ACS21767
UniProt: C5CR91
Position
1:5486067..5486675
Genome map
AA seq 202 aa AA seqDB search
MRIPAALAACLLAAGTAVAQAPSPNSSPSPTAAPADGTAAAACPSTLQHTFPRLQDEKPQ
SLCQYAGKVVLVVNTASFCGFTPQYKGLEALDSKYRARGLVVLGFPSNDFAQESGSNKEI
ADFCESTFGVKFPMFAKSSVRGANANPLFKQLALASGTTPKWNFYKYLIGRDGKVVQAWS
SMTAPDESAFVKVIESQLAAGG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatccctgccgccctggccgcatgccttcttgccgctggcacagcggtcgcacag
gccccctctcccaactcgtctcccagccccacagccgccccggccgacggcaccgccgct
gcggcctgcccgtccaccctgcagcacaccttcccgcggctgcaggatgaaaaaccccaa
tcgctgtgccagtacgcgggcaaggtggtgctggtggtgaacaccgcgagcttctgcggc
tttaccccgcaatacaaggggctggaggcgctggacagcaaataccgcgcgcgcgggctg
gtggtgctgggcttcccgtccaacgatttcgcacaggaatcgggctcgaacaaggaaatt
gccgatttctgcgaaagcaccttcggcgtgaaatttccgatgttcgcgaagtcgtcggtg
cgcggcgccaatgccaacccgctgttcaagcagctcgcgctggcctcgggcaccacgccg
aagtggaatttctacaaatacctgatcggacgcgacggcaaggtggtgcaggcctggtcc
agcatgacggcgcccgacgagagcgccttcgtcaaggtcatcgagagccagctcgcggcg
ggcggctga

DBGET integrated database retrieval system