KEGG   Variovorax paradoxus S110: Vapar_6375
Entry
Vapar_6375        CDS       T00916                                 
Name
(GenBank) Chloride channel core
Organism
vap  Variovorax paradoxus S110
SSDB
Motif
Pfam: Voltage_CLC CBS
Other DBs
NCBI-ProteinID: ACS22935
UniProt: C5D215
Position
2:complement(1121460..1123247)
AA seq 595 aa
MRQIDSSRTAMTPVPHPPRGDFALNARLLRITVMAIVVGAVSTVAARVLLDLIRFFTNLF
FFQTFSLADRSPAGHTLGAWVIAVPVIGGLIVGLVARYGSDKIRGHGIPEAIEAILFGKS
KMSPKVALLKPLSSGIVIGSGGPFGAEGPIIMTGGAIGSLIAQHFHLTAAERKALLVAGA
TAGMTAVFGTPVAAVLLAVELLLFELRPRSLLPVAVACAVAGFTRPLLMDAGPLFPLQTA
VPGPLAMLSCVAAGLLCGALSASLSISLYKVEDLFGKLPIHWMWWPAIGGLAVGIGGYFE
PRALGVGYDVIGDLLHNHLALGVVAALLAVKAVIWVISLGSGTSGGVLAPLLMMGAGLGV
VLSHVLPGNDPMLWPLVCMAATLGGVMRAPLTATIFAFGLTHDSNALLPLLTTSAVAYGF
TVLTMRRSILTEKIARRGYHIYREYGVDPLERHSVEEVMTREVRSIDAALPVARALFEHF
GDGQAHRAFPVVRNGTVIGVADRAMLAACGTRDPIATVGDACADVPLFFALPGENCRAVA
TRLARHRLERLPVVKDAQSLVLVGIVARSDLIKPSLAHFDEEEKRERMRGLPWQA
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgaggcagatcgactcttcccgaacagccatgactccagtcccccacccgccccgcggc
gacttcgccctcaatgcgcgcctgctgcgcatcactgtcatggccatcgtggtcggggcg
gtcagcaccgtggccgcgcgcgtgctgctcgacctgatccgcttcttcaccaacctgttc
ttcttccagaccttctcgctggcggaccgctcgccggccgggcacacgctgggcgcctgg
gtcattgcggtgccggtgatcggcgggctgatcgtggggctggtcgcgcgctacggctcc
gacaagatccgcggccacggcattcccgaggcgatcgaggcgatcctgttcggcaagagc
aagatgtcgccgaaggtcgcgctgctcaagccgctgtcctcgggcatcgtgatcggcagc
ggcggcccgttcggcgccgaagggccgatcatcatgaccggcggcgccatcggctcgctg
attgcgcagcacttccatctcacggccgcggagcgcaaggcgctgctggtggccggcgcc
accgcgggcatgacggcggtgttcggcacgcccgtggccgccgtgctgctggcggtggaa
ctgctgctgttcgagctccggccgcgcagcctgctgccggtggccgtggcctgcgcggtg
gcggggttcacacgtccgctgctgatggatgcgggcccgctgtttccgctgcagaccgcg
gtgcccggcccgctcgcgatgctctcgtgcgtggccgcggggcttctgtgcggcgcattg
tcggcctcgctctcgatctcgctctacaaggtcgaagacctgttcggcaagctgccgatc
cactggatgtggtggccggcgatcggcggcctggcggtgggcatcggcggctacttcgag
ccgcgtgcattgggcgtgggctacgacgtgatcggcgacctgctgcacaaccacctggcg
ctcggcgtggtggccgcgctgctcgcggtgaaggcggtgatctgggtgatctcgctgggc
tcgggcacttcgggcggcgtgctcgcgccgctcctgatgatgggcgcgggcctgggcgtg
gtgctctcgcacgtgctgcccggcaacgacccgatgctgtggccgctggtctgcatggcc
gccacgctgggcggcgtgatgcgcgcgccgctcaccgccaccatcttcgccttcgggctc
acgcacgacagcaatgcgctgctgccgctgctgactacctccgccgtggcctacggcttc
acggtgctgaccatgcgccgctcgatcctcaccgaaaagatcgcgcgccgcggctatcac
atctaccgcgaatacggcgtcgatccgctcgagcggcactcggtggaggaggtcatgacg
cgcgaggtgcgcagcatcgacgcggccctgccggtggcgcgggcgctgttcgagcatttc
ggcgacggccaggcccaccgtgcgttcccggtggtgcgcaacggcacggtgatcggcgtg
gcggaccgcgcgatgctggcggcgtgcggcacgcgcgatcccattgccaccgtgggcgac
gcgtgcgccgacgtgccgctgttctttgcgctgccgggcgagaactgccgcgcggtggcc
acgcggctcgcgcgccatcggctcgagcggctgcccgtggtgaaggacgcgcagtcgctg
gtgctggtgggcatcgtggcgcgcagcgacctgatcaagccttcgctcgcgcacttcgac
gaggaagaaaagcgcgagcggatgcgcgggctgccgtggcaggcctga

DBGET integrated database retrieval system