KEGG   Vigna angularis (adzuki bean): 108318845Help
Entry
108318845         CDS       T04660                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase At1g11300
Organism
var  Vigna angularis (adzuki bean)
Brite
Enzymes [BR:var01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108318845
Protein kinases [BR:var01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108318845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: B_lectin Pkinase_Tyr Pkinase S_locus_glycop PAN_2 ISK_Channel Orf78 TMEM154 SCF DUF5383 DC_STAMP LapA_dom
Motif
Other DBs
NCBI-GeneID: 108318845
NCBI-ProteinID: XP_017411728
Position
Un
AA seq 657 aa AA seqDB search
MALTSSTLASLTSFLCLCTFCVNAVIHKEFLQIGESMGTLDSVVSYTGKFELCFFTRIRD
NSTKYYVGIRYNRVPNDKNKIVWVANRDYAFQTPSAVLTFKDGNLVIIDGKLTYNVSNVS
NNISVYAMLLDSGNLILLKTSSKQILWQSFDYPTDTLLPIMKLGHDEGNTWSLRSWRSAD
DPDQGAFSLEYDLGRVSLIINNGSNAFWIDNHYNETIGNFTSRSGGYQHNLNDTRFNVGY
YFTLPVGNDSRLVLEVSGELIQEYWSDKEHQWISIQSSKCANNSCGAFSICNPKARDPCD
CLQGFRPSDADSWYNGNKSAGCVRKKDLSYCSNSVKSNDKFKQLYYVKSPTLDSLTKINT
TTTRECESTCSRNCSCVAYAYYVNGYCQLWLGSVLNLKNVSTDVANSDDSKPIFYLRLAA
AEVDTSDSNTTREKESRQTSVSKILLLIVMLISFVVFLILGLLVYWIRKKRRKGEDLLHF
DISMSMKVEDSELTEADRSAKVKKEVKLPLFSFESVAAATNNFSDANKLGEGGFGPVYKG
TLFNGDEVAVKRLSRRSGQGWEELRNEALLIAKLQHNNLVRLLGCCIDRNEKMLIYEFMP
NKSLDLFLFDATKKQMLDWGTRLRIIDGIVQGILYLHQYSRFRIIHRDLKASNILLD
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggcattaacttcctcaactctggcatccttgacatcattcctttgcctgtgtacgttt
tgtgttaatgcagtcattcacaaggaatttttgcaaataggagaatcaatgggaacctta
gactccgttgtttcttataccgggaagttcgaattgtgctttttcaccagaatcagagat
aactcaaccaagtactacgttggtatacggtataacagggtcccaaacgacaagaacaag
attgtctgggttgctaaccgagactacgcatttcaaacaccatcagcagttcttaccttt
aaagatggaaatttggtgatcatagatggaaaacttacatacaatgtcagcaatgtttca
aacaatatcagtgtctatgccatgctcttggattcaggaaacttgatactgctgaaaacc
tcaagtaaacagattttgtggcagagttttgattatcctacggacacccttttacccata
atgaaactaggacatgacgaaggaaacacttggtcattgcgatcatggagaagtgcagat
gaccctgaccaaggagctttttccctcgaatatgatttgggcagggtcagcctaatcatc
aacaatggttctaatgctttctggattgacaaccactacaacgaaactattggcaatttt
actagccgaagtggtggatatcagcacaacctcaacgatactcgtttcaatgtcggctac
tatttcactttgccagttggtaatgactctaggctggtactagaagtgtctggtgagctc
atccaggagtattggtctgataaagaacaccaatggatttctattcagtcatccaagtgt
gctaacaattcgtgtggagccttttccatctgtaacccgaaagctcgtgacccttgtgac
tgtcttcaaggtttcaggccctctgatgctgattcttggtataatgggaacaaatctgct
ggctgtgtaaggaaaaaagacttgtcgtactgcagtaacagtgttaaatccaacgataaa
ttcaagcaactttattatgtcaaatcaccaactttggacagtctcacgaaaatcaataca
acaacaacaagagagtgtgaaagtacttgttctagaaattgttcttgcgttgcttacgct
tactatgtgaacggatattgccagttgtggcttggttcggtattgaatctaaagaacgtc
tcaacagatgtggccaattctgatgatagcaaaccaattttttacctaagacttgctgcc
gcggaagtcgatacttcggattcgaacacaacaagagaaaaagaatcacgacaaacttct
gtgagcaagatcctacttctgattgttatgttgatctcctttgtagtttttcttatattg
ggccttttagtttactggattagaaagaagaggagaaaaggggaagatttgctccatttt
gatataagcatgagcatgaaagttgaagattctgagcttactgaagcagataggagtgcc
aaagtgaagaaggaagtgaaattgcctttattcagtttcgagagtgttgcagctgcaact
aataatttctcagatgcaaataaacttggtgaggggggctttggacccgtctacaagggt
acattatttaatggggatgaggttgctgtgaaaagactgtcacggagatctggtcaagga
tgggaagagttgagaaatgaagctttgttgattgcaaaactccaacacaacaatcttgtt
agacttctgggttgctgcattgatcgaaatgaaaagatgctgatttatgaatttatgcct
aataaaagcttggatcttttcctttttgatgcaacaaagaaacagatgctggattgggga
acaagactcagaataattgatgggattgtccaaggaattctttatcttcatcagtattcc
aggttcaggatcattcaccgagatttaaaagctagcaacatattgttggac

DBGET integrated database retrieval system