KEGG   Vigna angularis (adzuki bean): 108320417Help
Entry
108320417         CDS       T04660                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase, chloroplastic-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00030  Pentose phosphate pathway
var00480  Glutathione metabolism
var01100  Metabolic pathways
var01110  Biosynthesis of secondary metabolites
var01200  Carbon metabolism
Module
var_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
var_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    108320417
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108320417
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:var04147]
    108320417
Enzymes [BR:var01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     108320417
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     108320417
Exosome [BR:var04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   108320417
  Exosomal proteins of colorectal cancer cells
   108320417
  Exosomal proteins of bladder cancer cells
   108320417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 108320417
NCBI-ProteinID: XP_017407320
UniProt: A0A0L9TAH4
Position
Un
AA seq 589 aa AA seqDB search
MASILGPSLSIVRAYALRNEPLIVSKITAVGENSHSPLWFSCTRARKSARNHFQLKSSNG
LPLNAVSSNDGLAGTSLAKEDSKLQPLPELFPLSDSECTGSNLSITVVGASGDLAKKKIF
PALFALFYEDWLPENFIVFGFARTKMTDEELRNMISKTLTCRIDKRENCEDKMDQFLKRC
FYHSGQYNSEEHFSELDIKLKEKEGGKLSNRLFYLSIPPNIFVDVVRCASQKASSRDGWT
RVIVEKPFGRDSESSSELTKCLKQYLTEDQIFRIDHYLGKELVENLSVLRFSNLVFEPLW
SRNYIRNVQIIFSEDFGTEGRGGYFDHYGIIRDIMQNHLLQILALFAMETPVSLAAEDIR
NEKVKVLRSMRPLQLENAVVGQYKGHNKGGKSYPAYTDDATVPTGSLTPTFAAAALFIDN
ARWDGVPFLMKAGKALHTKRAEIRVQFRHVPGNLYKRNFGTDLDKATNELVLRVQPDEAI
YLKINNKVPGLGMRLDRSDLNLLFRARYPSEIPDAYERLLLDAIEGERRLFIRSDELDAA
WALFTPLLKELENKKIAPELYPYGSRGPVGAHYLAARHNVRWGDLGNED
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggccagtattctaggtccttctttaagcatagtcagggcctatgcattaagaaatgag
ccactaattgtctctaaaatcactgcagtaggagaaaactctcattcaccactatggttt
tcatgcactcgcgctagaaaatctgctagaaaccatttccagctcaaatcctcaaatggg
cttccactgaatgctgtctcttcaaatgatggtttagctggaacttcgttggctaaagaa
gatagcaagctccaaccacttcctgaactatttccattgtcagactcagaatgtacagga
tccaatcttagtataacagttgttggagcttctggagaccttgccaaaaagaagattttt
ccagcactctttgcactcttttatgaagattggctacctgagaattttattgtttttgga
tttgctcggactaaaatgaccgatgaagaattaaggaacatgattagcaaaaccttaaca
tgcagaattgacaaaagagaaaattgcgaagacaaaatggatcagttcttaaaaagatgc
ttttaccattctggtcaatataattctgaggagcacttttcagaattggatatcaagctg
aaagagaaagagggtggaaaattatcaaacagattgttttatttgtcaatacctccaaac
atatttgtggatgtggtgagatgcgctagccaaaaggcttcttccagagatggatggaca
agggttatcgttgaaaagccatttggccgtgactcggaatcatctagtgagctaacaaaa
tgcttgaagcagtacctcactgaagaccaaatattcaggattgaccattacttgggtaag
gagcttgtggagaatctatcagtgcttcgcttttcaaatcttgtttttgagcctctatgg
tcccggaattacattcgcaatgtgcagatcatattttctgaagattttggaactgaagga
agaggaggttattttgatcactacggaatcattcgggatataatgcaaaatcatcttctg
caaatactagctttgtttgcaatggaaacaccagtcagcttagctgctgaggacatcaga
aatgaaaaggtgaaggttctgagatcaatgagaccactgcagcttgaaaatgctgttgtt
ggtcaatacaagggccacaacaagggtggaaaatcatatcctgcttatacggatgatgca
actgttccaacgggtagtcttactccaacatttgcagcagcagctctttttatagacaat
gccagatgggatggggttccttttctcatgaaagctggcaaggctctccatactaaacgt
gcagaaatcagagtacaattcagacacgtcccaggtaacttgtacaagaggaattttgga
actgatctagacaaggctacgaatgagcttgtgcttcgtgtacaacctgatgaagctata
tatttgaaaatcaacaataaagtgccaggtctgggaatgagattagacagaagtgacttg
aatttgcttttccgagcaaggtatccaagtgaaataccagatgcatatgagaggttactc
ctagatgccattgaaggagagcgaaggctgttcattagaagtgatgagcttgatgcagct
tgggcactgttcactcctttgctaaaagaacttgaaaacaagaagattgctccagagctc
tacccctatggtagcagaggaccggttggagcacattaccttgctgcaaggcacaatgtt
agatggggagatcttggtaatgaagactaa

DBGET integrated database retrieval system