KEGG   Vigna angularis (adzuki bean): 108322089Help
Entry
108322089         CDS       T04660                                 

Definition
(RefSeq) autophagy-related protein 16
  KO
K17890  autophagy-related protein 16-1
Organism
var  Vigna angularis (adzuki bean)
Pathway
var04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:var00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    108322089
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:var04131]
    108322089
   03029 Mitochondrial biogenesis [BR:var03029]
    108322089
Membrane trafficking [BR:var04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    108322089
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    108322089
Mitochondrial biogenesis [BR:var03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    108322089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Ge1_WD40 Nup160 PQQ_2 Phage_GP20 Cytochrom_D1 UPF0242 Cep57_CLD_2 V_ATPase_I Phlebovirus_NSM
Motif
Other DBs
NCBI-GeneID: 108322089
NCBI-ProteinID: XP_017409555
Position
1
AA seq 553 aa AA seqDB search
MYCETQDFDGRDLGKRPLSWDAICRNPKGLCLNSVFVLVMAKTNKSQEEIACEAIKHALK
ALRKRHLLEEAAHGPAVLALSRPFVSQGSEWKEKAENLQVELQHCYKAQSRLSEQLVVEV
AESRASKALVQEKEIAVADLQKELTELRDECSQLKEDLEEKFKSLEVLVSENTELKAQLE
QMTTKANKAEAENKMLIDRWMLEKMKDAERLNEANALYEDMVEKLKASGLEQLARQQVDG
IVRQSEEGAEFFLESNIPSTCKYRLRAHEGGCASMLFEYNSSKLITGGQDRLVKMWDTNT
GSLSSTLHGCLGSVLDLTITHDNRSVIAASSSNNLYVWDVHSGRVRHTLTGHTDKVCTVD
VSKISSRHVVSAAYDRTIKVWDLVKGYCTNTIIFHSNCNALSFSMDGQTIFSGHADGNLR
LWAIQSGKLLSEVAAHTSAVTSISLSRNGNFVLTSGRDNLHNLFDVRSLEVCSTLKAAGN
RVASNWSRSCFSPDDNHVAAGSADGSVYIWSISKGDIVGTLKEHTSSVLCCTWSGIRKPL
ASADKNGVVCVWT
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtattgtgagacccaagattttgatggtagggatttgggtaaacgccctttgtcgtgg
gacgctatttgcaggaacccaaaaggtttatgcttgaattctgtttttgtgctagtaatg
gcgaaaacaaacaagtcgcaagaagaaattgcgtgtgaagctattaaacacgctttgaag
gcactgcggaagcgccatttgcttgaagaagccgctcatggtcccgctgttctagctctt
tctagaccctttgtttctcagggctctgaatggaaagagaaagcagagaatcttcaagtg
gaacttcagcattgctacaaagctcaatctcggctgtctgagcaacttgttgtggaagta
gctgagtccagagcttcaaaagcgttggttcaagagaaagaaattgcagttgctgatttg
caaaaggaattgaccgaattgagggatgagtgctctcaattaaaggaagacttggaagaa
aagtttaaatctctagaagtgcttgttagtgagaatactgaacttaaagcccaactggag
cagatgactactaaagcaaataaagctgaagctgagaataagatgttgattgaccgctgg
atgttggaaaagatgaaggatgctgaacgcctaaacgaggctaatgcactatacgaagac
atggtcgagaaactaaaggccagtggcttagagcaacttgcaaggcagcaggtggatggc
atagttcgccaaagtgaagaaggtgctgagttttttttagagtcaaacattccttccaca
tgtaaatacaggcttcgtgcacatgaaggtggttgtgcttccatgttgtttgagtacaat
tccagtaaattgattactgggggacaggatcgcttagttaaaatgtgggatacaaatacc
ggatccttatcttctacacttcatggctgccttggctcagtattagatctcactatcacc
catgataatcgatctgtcattgctgcaagcagctcgaacaacttgtatgtatgggatgtc
cactcaggccgtgtccgtcatacccttactggccacacagataaagtttgtactgttgat
gtgagcaagatttcaagtcgtcatgttgtcagtgctgcttatgaccgtaccataaaagtt
tgggacctagtgaaaggttactgcactaacacaatcatttttcacagcaactgcaatgct
ctctccttcagcatggatggtcagaccatattttcaggacatgctgatggtaatcttcgg
ttatgggccattcagagcggaaagctactcagcgaggttgctgcacatacatctgcagtt
acatcaatatccctttctcgaaatggaaattttgtactgaccagtggaagggacaatttg
cataatttgtttgacgtgcgatctcttgaagtttgtagcacactaaaagcggcaggaaac
agagttgcttctaactggagccgctcctgttttagtccagatgacaatcacgttgctgct
gggtctgccgatggatctgtgtatatttggtcaatttctaaaggtgatatagtcggtacg
ctcaaggaacatacttcttctgttctatgttgtacgtggagcgggatcagaaaaccccta
gcttcagctgacaagaatggggtagtttgtgtctggacataa

DBGET integrated database retrieval system