KEGG   Vigna angularis (adzuki bean): 108322961Help
Entry
108322961         CDS       T04660                                 

Definition
(RefSeq) ethanolamine-phosphate cytidylyltransferase-like
  KO
K00967  ethanolamine-phosphate cytidylyltransferase [EC:2.7.7.14]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00440  Phosphonate and phosphinate metabolism
var00564  Glycerophospholipid metabolism
var01100  Metabolic pathways
Module
var_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108322961
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    108322961
Enzymes [BR:var01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.14  ethanolamine-phosphate cytidylyltransferase
     108322961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like FAD_syn
Motif
Other DBs
NCBI-GeneID: 108322961
NCBI-ProteinID: XP_017410765
UniProt: A0A0L9TGU0
Position
Un
AA seq 420 aa AA seqDB search
MDYEHNSWIWEGVNYYPRVFGGLMVTAALLGLSTSYFGGIGVPYLSLPCSWSNLGIFHKK
KSGKRRIRVYMDGCFDLMHYGHANALRQAKALGDELVVGLVSDEEIVANKGPPVLSMSER
LALVSGLKWVDEVITDAPYAITEKFLDRLFHEYKIDYVIHGDDPCLLPDGTDAYAAAKKA
GRYKQIKRTEGVSSTDIVGRILSSLRNKKSCEDHNGSEVKPQEENPSQASHIAQFLPTSR
RIVQFSNGKGPGPNARIVYIDGAFDLFHAGHVEILKKARELGDFLLVGIHSDETVSEHRG
NHYPIMHLHERSLSVLASRYVDEVIIGSPWEITKDMITTFNISLVVHGTIAEKSLNCELD
PYEVPKSMGIFRLLESPKDITTATVAQRIMANHEAYVKRNAKKTRSEQRYYEEKKFVSGD
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggattacgaacacaacagttggatttgggagggggtaaactactacccgcgcgtgttt
gggggtctaatggttacagcagccttgctggggttgtcaaccagctactttggtgggatt
ggtgttccttatttgtcactgccatgttcttggtctaatttggggattttccacaagaag
aagtctgggaagaggcgcattcgggtttacatggatggatgttttgatctgatgcattat
ggccatgccaatgctctcagacaagcaaaggctcttggagatgaattggttgtgggtctc
gtgagtgatgaggagatcgtggccaataaaggaccacccgttttgtctatgtcagaaagg
ctggcccttgtcagtggattgaaatgggtggatgaggtcataaccgatgctccttatgca
attactgagaaattcttggatcgtctctttcatgaatacaaaattgactatgtcatacac
ggtgatgatccgtgcctgcttccagacggaacagatgcatatgctgcagcaaagaaagct
ggtcgttacaagcaaattaagcgtactgaaggagtttccagtacagatatcgtagggaga
atactgtcttctttaagaaataaaaaaagttgtgaagatcataatggcagtgaggtaaaa
cctcaagaagaaaacccatcacaggcttcccacatagctcaatttctaccaacttcccga
cgtattgtccagttttcaaatggcaagggtcctggaccaaatgcacgtattgtatacatt
gacggggcttttgatctctttcacgcaggccatgttgagatacttaagaaggctagggag
cttggagattttcttctagttggaatccactcagatgagaccgtgagtgagcatagagga
aatcactatccaatcatgcatctgcatgagcgtagccttagtgtgttagcttctcgttat
gttgatgaagttattattggttcaccttgggaaattacaaaggacatgatcaccactttt
aatatctcactagttgtgcatggtactattgctgagaagtcattaaattgtgagctagat
ccatatgaggtccccaagagcatgggaatattccgtttgctcgaaagcccaaaagatatt
actactgccactgtagcccaaaggataatggccaatcatgaagcttacgtgaaacgcaat
gctaagaaaactaggagtgagcaaagatactatgaagagaaaaaatttgtctccggagac
tag

DBGET integrated database retrieval system