KEGG   Vigna angularis (adzuki bean): 108323498Help
Entry
108323498         CDS       T04660                                 

Definition
(RefSeq) histidine kinase 4-like
  KO
K14489  arabidopsis histidine kinase 2/3/4 (cytokinin receptor) [EC:2.7.13.3]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:var00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    108323498
Enzymes [BR:var01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     108323498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHASE HATPase_c Response_reg HisKA MFS_Mycoplasma YniB HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 108323498
NCBI-ProteinID: XP_017411461
Position
Un
AA seq 990 aa AA seqDB search
MGLSLKMQSHHPVALRLYDQMGSKRKYTFIQAHRAWLPKFLLLWILLMALISWCIFSKMD
DDTKVRRKEVLGSLCDQRARMLQDQFSVSVNHVHALAILVSTFHYYRYPSAIDQETFAEY
TARTAFERPLLSGVAYAQRVVKSERERFEKEHGWVIKTMEEKSSLVRDEYAPVIFAQETL
SYLESLDMMSGQEDRENILRARATGKAVLTSPFRLLGSHHLGVVLTFPVYKSKLPQKPTV
EERIEATAGYVGGSFDVESLVENLLGQLAGNQAILVNVYDITNYTNPLIMYGKPYEEGDM
SLAHESKLDFGDPFRKHQMICRYHQKAPTNWIAVTTAFLFFVILILVGYILYGAGNHIVK
VEDDFHEMQELKVRAESAHVAKSQFLATVSHEIRTPMNGILGLLALLLDTELSSTQRDYA
QTAQACGKALITLINEVLDRAKIEAGKLELEAVPFDLRSILDDVLSLFSEKSRHKGLELA
VFVSDKVPDIVMGDPGRFRQIITNLVGNSVKFTEHGHIFVKVHLGDNRKCIMNGKHETFL
NGESDEVFLISDDYHFKTLSGREAADERNSWDNFKLLIGDEKCCLDSSREMVATCETSEQ
VTLRVCVEDTGIGIPFSAQDRIFMPFVQADSSTSRNYGGTGIGLSISKCLVELMGGKINF
ISRPQIGSTFSFTAVCGRFKKGPVTDMKKNLEDLPSSFRGLKVIVVDGKPVRAAVTRYHL
KRLGILVKVENSISKAVALYGKSGSLDSGMFLPDIIMVEKDTWISGEDGIFNMWKQNGHM
FKIPKMILLATNISNIEFDKAKAMGFTDTVIMKPLRASMVAACLQQVLGMGKKRQLGKDM
PNGSAFLHSLLYGKKILVVDDNGVNRRVAAGALKKFGADVKCAESGKAALEMLQLPHNFD
ACFMDIQMPEMDGFQATSQIRMMESKANEEMKNGSEWHVPILAMTADVIHATYDECLKRG
MDGYVSKPFEEENLYQEVAKFFKTKTISDS
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atgggtcttagtttgaagatgcagagccaccatcctgtggctttgaggttgtatgatcaa
atggggtctaaaagaaagtacactttcattcaggctcatagagcttggcttccaaagttc
ttgctgctgtggatccttctaatggctttgataagttggtgcatctttagcaaaatggat
gatgacactaaagtcagaaggaaggaggtgctgggtagcctctgtgatcaaagggcaaga
atgctacaggatcagtttagtgttagtgttaaccatgtccatgcccttgccatcctcgtt
tcaaccttccattactacagatacccttctgccattgaccaggaaacctttgccgagtat
acagcccggacagcatttgaacggccattactgagtggtgtggcatatgcacaaagagtt
gttaaatctgagagagagagatttgagaaagaacatggatgggttataaagacaatggaa
gagaagtcttcactggttagagatgagtatgccccggtgatatttgcacaagaaactctc
tcatatcttgagtctcttgatatgatgtctggacaggaggaccgagaaaacattttaagg
gctagagccactgggaaagcagttctgacgagccctttcaggctgttgggttctcaccat
cttggtgtggttttaacatttcctgtgtacaagtccaagctccctcagaagccaacagtg
gaagaacgcatcgaagcaactgcaggatatgttggaggatcctttgatgttgagtccctt
gttgagaatttacttggacaacttgctggtaaccaagcaatcttggtgaatgtatatgat
atcacaaactatactaatccactaataatgtatggaaagccctatgaagaaggtgatatg
tctcttgcccatgaaagcaagcttgattttggagacccattcaggaaacatcaaatgata
tgtaggtaccatcagaaggcaccaacaaattggattgctgttaccacggcatttctattc
tttgtgattcttatattagtggggtacattttatatggtgctggaaatcatattgtcaaa
gtggaagatgatttccatgaaatgcaggaactgaaagttcgagcagaatcagcccacgtt
gccaagtcccagtttctagctacggtctctcatgaaattagaacacccatgaatggtatc
ttaggattgcttgctctgcttctagatacagaattgagttcaacccaacgggattatgct
cagactgctcaggcatgtggaaaggcactgataacattaataaatgaggtgctggacaga
gctaaaatcgaagctggcaagttagagctggaggctgttccatttgatcttcgttccata
cttgatgatgttctttcccttttctctgagaaatctagacacaaaggtttagagctggct
gtgtttgtttctgataaagtaccggatattgtcatgggagatcctgggagattcagacaa
ataataacaaatcttgttggcaattctgtaaaattcactgaacacggacatatatttgtc
aaagtccatctaggggacaatagaaagtgcataatgaatggaaaacatgagacttttctg
aatggagaatcagatgaagttttccttatatctgatgattatcatttcaaaaccttaagt
ggacgtgaagcagctgacgaacggaacagctgggataattttaagctcctaattggtgat
gaaaaatgttgccttgattcttcaagagaaatggtggctacttgtgaaacatctgaacaa
gtcacattgagggtgtgtgtggaagacacaggaattggaatccctttttcagctcaggat
aggatattcatgccttttgtgcaggctgacagctcaacttcacgaaattatgggggtact
ggtattggcttgagtatcagcaaatgtctggttgaactgatgggtggtaagataaacttc
ataagccgaccccagattgggagcactttctcgtttactgcagtttgtggaagatttaag
aaaggtccggttactgacatgaagaaaaatttggaagatcttccttcaagttttagaggg
ctgaaagtcatcgttgttgatggaaaacctgttagagctgctgtgactagataccatttg
aagagactaggtatactagttaaggttgaaaatagcatcagtaaggctgttgctttatat
ggtaaaagtggttctctggactcaggaatgttcctgccagatattatcatggttgagaag
gacacgtggatatctggagaagatgggattttcaatatgtggaaacagaatggtcacatg
tttaagatacctaaaatgatccttctggcaaccaatattagtaacattgaatttgataaa
gcgaaggccatgggtttcactgatactgtgatcatgaagcccctgagagctagtatggtg
gctgcttgtcttcagcaagttttggggatggggaagaagaggcagctagggaaagacatg
ccgaatggttctgcttttctacacagccttctctatggaaagaaaatcttggtggttgat
gacaatggggtaaaccgaagggttgctgcaggtgctctgaaaaagtttggagctgatgtg
aagtgtgcagaaagtggcaaagcagcacttgaaatgctgcaattgcctcacaattttgat
gcttgcttcatggacattcaaatgccagaaatggatggatttcaagcaactagccaaatt
cggatgatggagagcaaggcaaatgaggagatgaagaatgggagtgagtggcatgtgcct
atattggccatgacagctgatgtgatccatgctacatatgatgagtgcttgaaacgtggc
atggatggatatgtatcaaagccattcgaggaagagaatctgtatcaggaagttgcaaag
tttttcaaaacaaagaccatctcagactcataa

DBGET integrated database retrieval system