KEGG   Vigna angularis (adzuki bean): 108325906Help
Entry
108325906         CDS       T04660                                 

Definition
(RefSeq) probable glutathione peroxidase 5
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00480  Glutathione metabolism
var00590  Arachidonic acid metabolism
var01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108325906
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108325906
Enzymes [BR:var01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     108325906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Xrn1_D3
Motif
Other DBs
NCBI-GeneID: 108325906
NCBI-ProteinID: XP_017414528
UniProt: A0A0L9TWT3
Position
2
AA seq 170 aa AA seqDB search
MGASQSISENSIHEFTVKDARGKDVNLNAYRGKVLLVINVASKCGFADANYTQLTQLYST
YKSRGLEILAFPCNQFLKKEPGTSIEAHDFACTTYKAQYPIFGKIRVNGSDSAPVFKFLK
AQKSGFVGSRIKWNFTKFLVDEEGHVINRYSPTTKPLAIEKDIKKALRLA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcttctcaatcaatctcagaaaattctatccacgaattcactgtaaaggatgcg
aggggcaaagatgtgaacctaaacgcttacaggggcaaagttcttcttgtaattaatgtt
gcttcaaaatgtggatttgctgatgccaattacacgcagttaactcagctttattcgaca
tacaagagcaggggtcttgagatattggcatttccatgtaatcaatttttgaagaaagag
cctgggactagcatcgaggcacatgactttgcatgtacaacatataaggctcagtatcct
atttttgggaagatacgtgtgaatggatcagacagtgcaccagttttcaaattcctgaaa
gcacagaaatctggatttgtgggatctagaatcaaatggaatttcactaagtttttagtt
gatgaagaaggccacgtcatcaaccgttatagcccaaccaccaagccattagccattgaa
aaagacatcaagaaagcattgcggttggcttga

DBGET integrated database retrieval system