KEGG   Vigna angularis (adzuki bean): 108325995Help
Entry
108325995         CDS       T04660                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein 2-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
var  Vigna angularis (adzuki bean)
Pathway
var03040  Spliceosome
var04141  Protein processing in endoplasmic reticulum
var04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:var00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108325995
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108325995
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108325995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:var01009]
    108325995
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:var03041]
    108325995
   03009 Ribosome biogenesis [BR:var03009]
    108325995
   03110 Chaperones and folding catalysts [BR:var03110]
    108325995
   04131 Membrane trafficking [BR:var04131]
    108325995
   03051 Proteasome [BR:var03051]
    108325995
   03029 Mitochondrial biogenesis [BR:var03029]
    108325995
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:var04147]
    108325995
Protein phosphatases and associated proteins [BR:var01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     108325995
Spliceosome [BR:var03041]
 Complex B
  Other components
   Prp19 complex
    108325995
 Complex C
   Prp19-CDC5 complex
    108325995
Ribosome biogenesis [BR:var03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    108325995
Chaperones and folding catalysts [BR:var03110]
 Heat shock proteins
  HSP70 / DNAK
   108325995
Membrane trafficking [BR:var04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108325995
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    108325995
Proteasome [BR:var03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108325995
Mitochondrial biogenesis [BR:var03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    108325995
Exosome [BR:var04147]
 Exosomal proteins
  Proteins found in most exosomes
   108325995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DDR FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 108325995
NCBI-ProteinID: XP_017414678
Position
2
AA seq 648 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVFSGPGDKPMIQVNYKGEDKQFSA
EEISSMVLMKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKRTVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKK
KVEAKNALENYAYNMRNTVKDEKIGGKLDPADKKKIEDAVEQTIQWLDSNQLGEADEFED
KMKELESICNPIIAKMYQGGAGPDMGGGMDDDVPAGGSGAGPKIEEVD
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggccggcaagggtgagggtccagccatcggaatcgatcttggaaccacgtactcctgc
gttggtgtctggcagcatgatcgcgtcgagatcattgccaacgaccaaggtaacagaacg
acaccgtcttatgtcgggttcaccgacaccgagcgtctcatcggtgatgccgccaagaac
caggtcgccatgaaccctattaacaccgtttttgatgccaagagattgattggtcgtagg
ttcaccgatgcctctgttcagagtgatattaaattgtggccttttaaggtgttttctgga
cccggtgataagccaatgattcaggttaactacaagggtgaagataagcagttttccgct
gaagaaatctcttctatggtacttatgaaaatgcgtgagattgctgaagcttatcttggc
actacgataaaaaatgctgttgttactgtccctgcttactttaacgattctcagcgtcaa
gctaccaaggatgctggtgttattgctggtcttaatgtcatgcgtattatcaatgagcct
actgctgcggctattgcttatggtcttgacaagaaggctaccagcgtcggtgagaagaat
gtgttgatttttgatctagggggtggtacctttgatgtctctttgctaaccattgaagag
ggtatctttgaggtgaaagccacagctggggacactcatctcggaggtgaggattttgat
aacaggatggtgaatcattttgttcaggagttcaagagaaaaaacaagaaggatatcagt
ggcaaccccagagcacttaggaggttgaggactgcttgtgagagggcaaaaagaactctg
tcctccactgcccaaaccaccattgaaattgattctctgtatgaaggaattgatttctat
tccaccattacccgtgcaaggtttgaagagcttaatatggatctcttccggaagtgcatg
gaaccagttgagaagtgtttaagagatgctaagatggacaagaggactgtccatgatgtt
gttcttgttggtggttctaccagaattcccaaggttcaacaacttctgcaggatttcttt
aacgggaaggagctctgcaagagcatcaatcctgatgaggctgtggcatatggtgctgct
gtacaagctgctatcttgagtggtgagggtaacgagaaggtgcaagatcttctcctgctt
gatgtcaccccactctctctcgggttggaaactgctggtggggttatgactgtcttgatc
cccaggaacactacaatcccaacaaagaaagaacaggttttctcaacctattctgataac
cagccaggtgttttgatccaggtttatgaaggtgagagaacaaggaccagagataacaat
ttgctgggtaaatttgaactttcgggcattcctcctgcacccaggggtgttcctcaaatc
acagtgtgcttcgacattgatgccaatggtatcttgaatgtctctgccgaagacaaaact
actggccaaaagaacaagatcaccattaccaacgataagggtaggttgtcaaaggatgaa
attgagaagatggtgcaagaggctgagaagtacaagtctgaagatgaagagcataagaag
aaggtagaagcaaagaatgcattggagaactacgcatacaacatgaggaatactgtgaag
gatgagaagattggaggaaagcttgacccagctgacaagaagaagatcgaggatgctgtt
gagcagactatccagtggctggacagcaaccaacttggagaggcagatgagtttgaggac
aaaatgaaggaattggaaagcatctgcaatcctatcattgccaagatgtaccagggaggt
gctggtccagacatgggaggtggaatggacgatgatgtgcctgctggtggaagtggtgct
ggtccaaagattgaggaagtagattaa

DBGET integrated database retrieval system