KEGG   Vigna angularis (adzuki bean): 108326121Help
Entry
108326121         CDS       T04660                                 

Definition
(RefSeq) phosphatidylinositol-3-phosphatase myotubularin-1-like
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00562  Inositol phosphate metabolism
var01100  Metabolic pathways
var04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    108326121
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    108326121
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:var01009]
    108326121
Enzymes [BR:var01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     108326121
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     108326121
Protein phosphatases and associated proteins [BR:var01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    108326121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM Y_phosphatase BBL5 3-PAP bPH_3 Y_phosphatase3 Fez1 Laminin_II
Motif
Other DBs
NCBI-GeneID: 108326121
NCBI-ProteinID: XP_017414890
UniProt: A0A0L9TYH6
Position
2
AA seq 848 aa AA seqDB search
MDVPKHRATRTTSLRDVSDFSKMEVTGSWDALEWTKIEPITPFVSNASFDFLIEAEQVVA
EGHGVVLVNTDDAGTLMVTNFRLIFLSEGTRKVISLGTIPLATIEKFNKIVVKVQSNNRS
VDKTPAQRLLQVIGKDMRILVFSFRPRTKQRRLVFDALLRCTKPTRLWDLYAFASGPSRF
KNTTPLVRLLDEYCRLLCLGSYHASIDIIENGSFTWSNELWRISSVNSSYTMCQSYPFAL
VVPKIISDEEVLQASSFRARCRLPVVSWCHPLTGAVVARSSQPLVGIMMNMRSNMDEKLV
AGLCSKLDNGSRRKLYIVDARPRKNALANGAMGGGSESSSNYFQSEVVFLGIDNIHAMRD
SFVRLREYMDTHGRASSDGMSSFLRQGGSTWGGGNLSSMSASVSTLGDIGWLLHVQNVLA
GAAWIAARVAIENSSVLVHCSDGWDRTSQLVSLANLLLDPYYRTFTGFQALVEKDWLAFG
HPFSDRVGMPSVSGTGNMPFELSRQPSTGNFAPSPMHQSTGTFSSQPPASSHSHNSNNYS
PIFLQWVDCVSQLLRMYPFAFQFSAAFLVDFIDCMLSCRFGNFLCNSEKERQKCNVFEAC
GCLWVYLADLRTSEGGSHVHYNPFYDPLKHNGPLLPPAAALAPTLWPQFHLRWACPEEAQ
AGEIEAQCRKIVMKCSETQKAKEMAERKVKEVTNSMESLNAELRREKQINSSAMNMAKSV
SKENMAIKRAIQSMGCKVHVSGSGECTVDIESNPDILCCSSRKESNSNVRDDKTDPPVSV
LVTADDDDDGNNGIVRVCETLCPFGSGGGGCRWPNGGCAQLGSQYVGLKANFDAFDQLSI
NDSYFKSE
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgccgaagcaccgtgccactcgaacaacctctctacgggacgtctccgacttc
tccaagatggaagtaaccggaagctgggacgccctcgaatggaccaaaattgagccaatt
acgcccttcgtctcgaatgcgagtttcgatttcttgatcgaggcggagcaagttgtcgcc
gaaggacatggtgttgttcttgttaatacagatgatgctggcacattgatggtaacaaat
ttccgtcttatttttctgagtgagggaactagaaaagttatttcccttggaacgattcca
ctagcaaccattgagaagtttaacaagatagttgtaaaggttcagtcaaataatcgttct
gtagacaagacaccagctcagagactgctccaggtgattggaaaagatatgagaatttta
gtcttcagtttcagaccacgtacaaaacagagacgtttggtgtttgatgcgctactgagg
tgtacaaagccaacaagattatgggatctttatgcttttgcatcaggaccttctaggttt
aagaacactactccactggtccgtttactagatgaatattgtcggcttctttgcctaggt
tcttatcatgcatcaatcgatataattgaaaatgggtcgttcacctggtcaaatgaacta
tggagaataagtagcgtgaattccagttatacaatgtgccagagttatccatttgctttg
gttgttccaaagatcattagtgatgaagaagtgctccaggcatccagcttccgtgcaaga
tgtcgactgcctgtagtttcatggtgccatccattgactggagcagttgttgcacgatct
tctcaacccttagttggtattatgatgaacatgaggagcaacatggatgaaaaacttgtg
gccggactctgtagcaagctagataatggctcaaggagaaagttatatattgttgatgca
cggccaagaaaaaatgcattggctaatggagccatgggaggtggttcagaatcatcgtca
aactattttcaatctgaggtagtcttcttggggatagacaacatccatgcgatgagagac
agctttgttcggctccgagaatacatggacactcatggcagagcgtcatcagatggaatg
tcctctttcttgagacaaggtgggtctacgtggggtggtggcaatctaagtagtatgtct
gcttcggtatcaacccttggggacattggatggttactgcatgttcagaatgtgttggct
ggagcagcttggattgctgctcgtgttgcaattgaaaactcttctgttcttgtgcattgc
agtgatggatgggatagaacaagccagttggtttcacttgctaatttgttgcttgatcca
tactatcggacattcacagggtttcaggcacttgttgaaaaagactggcttgcttttggt
catccattttctgaccgggtgggaatgccatctgtctctggaactggcaacatgcctttt
gagttatctaggcagccttcaactggaaattttgcaccatcacccatgcaccagtcaaca
ggaacattttcatcacaacctccagcttcatctcactcccataactccaacaactattct
cctatttttttgcagtgggttgattgtgtttcacaattattgcggatgtatccttttgct
tttcaattctcggcggctttcctggtggacttcatagactgcatgctttcttgtcgtttt
ggaaacttcttatgtaacagtgagaaggagaggcagaaatgcaatgtttttgaggcatgt
ggatgtctgtgggtttatttagctgatttacggacatcagaaggaggttcccatgtgcat
tacaatcccttctatgatccactcaagcataatggtcctcttctacccccagcagcagca
ttggcgcctacgttatggccccaattccaccttcgttgggcatgcccagaagaagcacaa
gctggggagattgaagcgcaatgcaggaagatagttatgaaatgctctgagacgcagaag
gctaaagaaatggcagaaagaaaagttaaagaagttacaaattccatggagtcactgaat
gctgaattacgacgtgagaagcagataaacagctcagctatgaacatggcaaagagtgtg
agcaaagaaaatatggctataaagcgtgcaattcagtcaatggggtgcaaggttcatgtc
tctggtagtggtgaatgcactgttgacattgaaagcaacccagacattctgtgttgttcc
tcaagaaaagaatcaaatagtaatgtgcgtgatgacaaaacggacccacctgtttcagta
ctagttacagcagatgatgatgatgatggaaacaatgggattgttagggtatgtgaaact
ctatgcccatttggctctggaggtggaggctgcaggtggccaaatggtggttgtgctcaa
ttaggtagccagtatgttggcctcaaggcaaactttgatgcatttgaccaactgtcaatt
aatgatagttatttcaagtctgagtga

DBGET integrated database retrieval system