KEGG   Vigna angularis (adzuki bean): 108326294
Entry
108326294         CDS       T04660                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00100  Steroid biosynthesis
var01100  Metabolic pathways
var01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    108326294
Enzymes [BR:var01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     108326294
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 108326294
NCBI-ProteinID: XP_017415192
Position
2
AA seq 373 aa
MESNVDLSFLLHALMPSWNSVPLLTGFFTYLAIAGSILPGKIVPGVALPDATRLHYRCNG
LLSLLLLVALLGIGANMGFVSPTAISDRGLELLSTTFLFSFLVTLVLYFSGCESQSKGSS
LKPHISGNLIHDWWFGIQLNPQFMGIDVKFFFVRAGMMGWLLINLSILMKSIQDGTLSQS
MILYQLFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLKNN
VELTTAAMVANCFVFLIGYMVFRGANKQKHVFKKNPKAPIWGKPPKVVGGKLLASGYWGV
ARHCNYLGDLLLALSFSLPCGISSPIPYFYPVYLLILLIWRERRDETRCADKYKEIWTEY
RKLVPWRILPYVY
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggagtcgaacgtggatctgagttttctcctacacgctctcatgccatcttggaactcc
gttcctttgcttacggggttcttcacttacttggccattgctggatccattctccctgga
aaaattgttcctggggttgctctacctgatgcaactcgtcttcactatcgctgcaatggt
ctgctctcgcttcttctgttggttgcgcttcttgggatcggtgccaatatgggttttgtg
tctcccactgccatatcagacagaggacttgagttgctgtccacaacgtttctctttagt
tttcttgtgactctggtattgtatttttctggttgcgagtcacaaagtaaaggttcatct
ctaaaacctcatatcagtgggaacctgatacatgattggtggtttggaatacaactaaat
cctcaattcatgggtattgacgtcaaatttttctttgttagagctggaatgatggggtgg
ctacttatcaatttatctattcttatgaagagcattcaagatggtactttgagccagtca
atgattctctaccagctattctgtgcactatacatcctggactattttgtacatgaagaa
tacatgacatccacctgggacataattgcagagagattgggcttcatgttggtgtttgga
gatttagtgtggatacctttcactttcagcatacaggggtggtggctattgaagaacaat
gtggagttaacaacggctgccatggtagctaattgctttgtcttcttgatcggatatatg
gtatttcgaggggcaaacaagcaaaaacatgtgttcaaaaagaatccaaaggctcctatt
tggggtaagcctccaaaagttgttggaggcaagctactagcgtctggttattggggtgtt
gctaggcactgtaattacctaggagatttgctacttgctctctcttttagcttaccttgt
gggataagttccccaattccatacttctatccagtttatcttcttattctgttgatctgg
agagagagaagggatgaaactcgctgtgcagataagtataaagagatatggacagagtat
cgtaaacttgttccatggagaatattgccttatgtttattag

DBGET integrated database retrieval system