KEGG   Vigna angularis (adzuki bean): 108327324Help
Entry
108327324         CDS       T04660                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00601  Glycosphingolipid biosynthesis - lacto and neolacto series
var00603  Glycosphingolipid biosynthesis - globo and isoglobo series
var01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    108327324
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    108327324
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:var01003]
    108327324
Enzymes [BR:var01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     108327324
Glycosyltransferases [BR:var01003]
 Glycan extension
  P blood group
   108327324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gly_transf_sug Gb3_synth Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-GeneID: 108327324
NCBI-ProteinID: XP_017416529
Position
3
AA seq 438 aa AA seqDB search
MLLLHEFFPIAILIAKRVLTCNRMFDDRLLKRSKIAIFCLITFSAIIFFILCDDLIYQDS
LRPSATKGPEEVLQARPHRNGEGIRSTLVLTHSPLRSMQQNEGVGKGNQGILVAPFNSTE
EERIVWFKGKLHEFKILQSDGLSRQFHARILGFFSHECESQFFMTWEYPAGSFEARELLS
IESLFKVHPKACLAILSRTLDSILGYRILKPLLDRRFRVQAVAPDLPFLFKGTPAEAWLN
ELMKGKKDPGKISLFQNLSNLMRLAVLYKYGGVYLDTDFIVLKPLSVLRNSIGAQSMDSG
NKNWTRLNNAVLIFDMNHPLLLRFINEFVLTFNGNKWGHNGPYLVSRVVERLGERPGFNL
TILPPLTFYPADLKKIGGLFGKPKTRGESKWVEAKLLQLSSESYGVHLWNKESRNLKIED
GSVVARLICDRCIICKYL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgttgcttctgcatgagttctttccaattgcaattctcatcgcaaaaagagttttaact
tgtaacagaatgtttgatgaccgacttctcaaacgttctaagatagctatcttctgtcta
atcactttctcagccataattttttttatcctttgtgatgatcttatttaccaggattcc
ctacgcccttctgcaaccaaaggaccagaagaagtgttgcaagctcgacctcacagaaat
ggagaggggataaggtcaactcttgttctcacacactcccctttacgttccatgcaacag
aatgaaggagttggcaaaggaaatcaaggaatcctagttgctccatttaattccacagaa
gaagaaagaattgtttggtttaaagggaagcttcacgagttcaagattctccagtcggat
ggattgagtaggcaatttcatgctcggattctgggatttttcagccatgaatgtgagtct
caatttttcatgacttgggagtaccctgcaggctcatttgaagcaagagagttgttgtct
atagagagtcttttcaaggtgcatcccaaggcttgtttggcgattctatcaaggactttg
gattccattcttggttataggatcctgaagccacttcttgataggaggttcagagttcaa
gcagtggccccagacttgccatttctcttcaagggaactccagctgaagcatggctgaat
gagttgatgaaagggaagaaggacccaggtaagatttctctgtttcagaacctatctaac
ttgatgagacttgcagttctgtacaaatatggtggtgtgtacctagacacggattttata
gtcttgaaacctttatctgtgttgaggaattctattggagcacaaagcatggactctggg
aataagaactggactagacttaataatgcagtcctgatatttgacatgaatcatccactt
cttctcagattcattaatgaatttgtgttaacttttaatgggaacaaatggggtcataat
ggtccctacctggtttccagagtggttgagagactgggggaaaggccaggcttcaacctt
acaatcttgcctcctttgaccttttatccagcagatttgaaaaagattggtggtctcttt
gggaagcccaaaactagaggtgaatcaaaatgggttgaagccaaactgcttcagctaagt
agtgagagttatggggttcatttatggaacaaagaaagtaggaatttgaagattgaagat
ggaagtgtcgtagctagactcatatgtgatcgttgtatcatttgcaagtatctgtag

DBGET integrated database retrieval system