KEGG   Vigna angularis (adzuki bean): 108329566Help
Entry
108329566         CDS       T04660                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase 4, chloroplastic
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00030  Pentose phosphate pathway
var00480  Glutathione metabolism
var01100  Metabolic pathways
var01110  Biosynthesis of secondary metabolites
var01200  Carbon metabolism
Module
var_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
var_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    108329566
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108329566
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:var04147]
    108329566
Enzymes [BR:var01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     108329566
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     108329566
Exosome [BR:var04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   108329566
  Exosomal proteins of colorectal cancer cells
   108329566
  Exosomal proteins of bladder cancer cells
   108329566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N DUF302
Motif
Other DBs
NCBI-GeneID: 108329566
NCBI-ProteinID: XP_017419314
UniProt: A0A0L9U942
Position
3
AA seq 614 aa AA seqDB search
MSVSFSSTSLPFSESSFAFQRHPRLCSNPLTVASNNFHSVTCGGRLALNVGGTSLCRRFR
GFKLWVLERLNFQFQSPKQPKNRIRIENNLENSGLSNEKGPVSDSSSILHAPDGMVTSME
YPSLLQTGLSATPMDVSGKPSLCISVIGATGELAKSKIFPALFALYYSGFLPENVGIFGY
SRKDITDEDLRSIIASTLTCRVDHQENCADKLDAFLRRTYHINGGCDNKYGMSMLNARME
QIEGGSKTNRIFYLSVPQEAVLDVTACLSSSAQTQKGWNRIIFEKPFGFDALSSYRMTQY
LLSNFEEKQIYRIDHLLGRNLIENLTVLRFSNLVFEPLWSRTYIDNLQVILSEDLTKHLG
RYFSGYGIIRDIVHSHILQTIALLAMEPPVSLDGEDIRNEKVKVLRSIRKLEPKDVILGQ
YRASGGAKVDTCLNGLTPTYFAAALYIDNARWDGVPFFIKTGLGLIKHQMEIRIQFRNVP
GNVYRECMGHNMDRAVNELILRDVPDEAILVRVNNKVPGLGLQLDSSELNLLYKDKYNME
VPDSYEQLLLDVIDGDNHLFMRSDELEAAWNILTPILNEIDKENISVELYEMGGRGPVGA
YYLWAKHGVRWVED
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgtcgttctcttcaacttcgcttccgttctccgaatcttcattcgcattccaa
agacatccacgtctttgctctaatccactcacagttgcatcaaataacttccactcagta
acttgcggtggtcgtcttgcactgaatgttggaggcacaagcttgtgtcgaagatttcgt
ggcttcaaactgtgggtacttgagagactcaactttcaatttcagtcaccaaagcaacct
aagaatagaattcgcatcgaaaataatttggaaaattcgggtttatcaaatgaaaaggga
ccagtttctgattcatcctcgattctccatgctcctgatggtatggtcacttccatggag
tatccttctttgctgcagacaggtttgtctgctactcccatggatgttagcgggaaaccc
tcactttgcatttctgtcataggagccaccggtgagctggcaaagagtaagattttccct
gctttatttgccctctactacagtggctttcttcctgagaatgtaggcatttttgggtat
tcgaggaaggatataacggatgaagacctgcgatctattatagcttcaacattaacatgc
cgagttgatcatcaagagaattgtgcggacaaattagatgctttccttcgtagaacatat
catattaatggaggctgtgacaataaatatgggatgtccatgctgaatgcccgaatggag
caaattgagggaggatccaaaaccaacaggatattctacctttctgtgccacaagaagca
gttttagatgttacggcttgtctttctagcagtgctcagactcaaaagggatggaatcgc
ataatatttgagaagccatttggctttgatgcactttcttcctataggatgacacaatat
cttctttcaaactttgaggaaaagcaaatatataggattgatcatcttctaggaaggaat
ctcattgaaaatctcacagttttaaggttttcaaatctagtttttgagccactttggagt
cgtacttacatagacaatctacaggtcattttatcagaggacctgaccaagcatctagga
agatatttcagtggctatgggattatccgtgatattgttcatagtcacattctccagaca
attgcattgcttgcaatggaaccaccagtaagccttgatggagaagatattcgaaatgaa
aaggttaaggttttgaggtcaattcgaaaattggagcctaaggatgtcattcttgggcaa
tatagagcaagtggtggagccaaagttgatacatgcttaaatggtctgacacctacttat
tttgctgctgcactatacattgacaatgcacgatgggatggtgtgccattttttattaaa
acaggcttgggactcatcaaacaccaaatggagatacggatacaatttcgaaatgttccg
ggtaatgtgtaccgtgagtgcatggggcataacatggaccgtgctgtgaatgagctcatt
ctccgtgatgttcctgatgaagctattttggtgagagttaacaacaaggttccaggacta
ggcttgcaactggactcttcagaactaaatttgctttacaaggacaagtacaacatggag
gttccagattcgtatgagcaacttcttcttgatgtcattgatggggacaaccatttgttc
atgagaagtgatgaactggaagcagcatggaacattctaactccaattctgaatgagata
gacaaagaaaacatatcagtggagctttatgagatggggggtcgaggtcctgttggggca
tactacctttgggcaaaacatggggtccgttgggtagaggattaa

DBGET integrated database retrieval system