KEGG   Vigna angularis (adzuki bean): 108330613Help
Entry
108330613         CDS       T04660                                 

Definition
(RefSeq) palmitoyl-acyl carrier protein thioesterase, chloroplastic-like
  KO
K10781  fatty acyl-ACP thioesterase B [EC:3.1.2.14 3.1.2.21]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00061  Fatty acid biosynthesis
var01100  Metabolic pathways
var01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    108330613
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:var01004]
    108330613
Enzymes [BR:var01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.14  oleoyl-[acyl-carrier-protein] hydrolase
     108330613
    3.1.2.21  dodecanoyl-[acyl-carrier-protein] hydrolase
     108330613
Lipid biosynthesis proteins [BR:var01004]
 Fatty acid synthase
  Component type
   108330613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-ACP_TE Acyl-thio_N
Motif
Other DBs
NCBI-GeneID: 108330613
NCBI-ProteinID: XP_017420594
UniProt: A0A0L9UBL3
Position
4
AA seq 414 aa AA seqDB search
MVATAVTASFIPVVPSPDSGKGKQTQLGGGSASLRGLQPRNGLCGGLQVKANAHAPPKVN
DTVKVEDDLPSSSSLTPAPRTFINQLPDWSMLLAAITTAFLAAEKQWMMLDWKPRRPDML
VDPFGIGKIVEDGLVFRQNFSIRSYEIGADKTASIETMMNHLQETALNHVKTAGLLGDGF
GSTPEMCKKNLIWVVTKMQVVVDRYPKWGDVVQVDTWVSASGKNGMRRDWLVRDAQTGEI
LTRASSVWVMMNKVTRKLSKIPEEVRGEIGTYFVDSAPVVEEDKRKLSKLDDSANFIRTG
LSPRWSDLDVNQHVNNVKYIGWILESAPQPLLESHELCAMTLEYRRECGRNSVLDSLTDI
SGANVGSLADGGLFECKHLLRLEDGAEIVRGRTEWRSKSANNFGVLSQVSAEST
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaacagccgtaacggcgtcatttatccctgttgtgccttcgccggactctgga
aaagggaagcagacgcagttgggtggtgggtctgcgagcctgagaggactccaaccgaga
aatggtttatgcggtggcttgcaggtgaaggcaaacgctcatgcccctccgaaggttaac
gacaccgtgaaggttgaggatgatttgccatcttcatcgtcacttactcctgctccgagg
actttcatcaaccagttaccggattggagcatgcttctcgctgccatcaccaccgccttc
ctagctgcggagaagcagtggatgatgctcgattggaagccgcgccggcccgacatgctc
gttgacccctttgggataggaaagattgtggaggacgggcttgtgttcaggcagaacttc
tcaattcggtcctacgaaattggcgctgacaaaaccgcgtctatagagacgatgatgaat
catttgcaggagacagctcttaatcatgttaagactgcggggcttcttggtgatggtttt
ggctccacgcctgaaatgtgtaagaagaacttgatttgggtggttaccaagatgcaggtt
gtggttgatcggtatcctaaatggggtgatgttgttcaagtcgatacttgggtttccgca
tcaggaaagaatggtatgcgtcgtgattggcttgtgcgtgatgcccaaacgggtgaaatc
ttgacaagagcctccagtgtttgggtcatgatgaataaagtgacaaggaaactgtctaaa
attcccgaagaagtcaggggagagataggcacttattttgtggattctgctccagttgtg
gaagaggataaaagaaaactatccaaacttgatgattcagctaatttcattcgcactggt
ttaagtcctagatggagtgatctagatgttaaccagcatgttaacaatgtgaagtacatt
gggtggattctggagagtgctccacaaccacttttggagagtcatgagttatgtgccatg
actttggagtacagaagggagtgtggcaggaacagtgtgctggattccctgactgatata
tctggtgctaatgtaggcagtttagccgacggtggactttttgagtgcaaacacttgctt
cgacttgaagatggtgctgaaattgtgagaggtaggaccgaatggagatccaagtctgca
aacaactttggagttctgagtcaggtttcagcagaaagcacctaa

DBGET integrated database retrieval system