KEGG   Vigna angularis (adzuki bean): 108331941Help
Entry
108331941         CDS       T04660                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK3
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
var  Vigna angularis (adzuki bean)
Brite
KEGG Orthology (KO) [BR:var00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:var01001]
    108331941
   01009 Protein phosphatases and associated proteins [BR:var01009]
    108331941
Enzymes [BR:var01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108331941
Protein kinases [BR:var01001]
 Serine/threonine kinases: Other
  Wnk family
   108331941
Protein phosphatases and associated proteins [BR:var01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108331941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 108331941
NCBI-ProteinID: XP_017422462
Position
4
AA seq 610 aa AA seqDB search
MLPDSSEQDLDDPDMEFVEVDPSGRYGRYKEVLGKGAFKKVYRAFDELEGIEVAWNQIKL
ADVLRNSEDFERLYSEVHLLKTLKHKNIIKFYNSWIDSKSENINFITEIFTSGTLRQYRK
KHKHVDLRAVKKWSKQILEGLHYLHSNNPPIIHRDLKCDNIFVNGNQGEVKIGDLGLAAI
LQQANSAHSVIGTPEFMAPELYEEEYNELVDIYAFGMCLLELVTVEYPYVECANAAQIYK
KVTSGIKPASLAKVTDPEVKAFIEKCIAHVSERLSAKDLLMDPFLQSDYDNESVGRSSKA
QTHHLANISHNQAIVVDTSAEASREFTVEGQRRDNNTIFLKLRIADSSGHIRNIHFPFDI
EADTSTSVASEMVEELELTDQDVTTIARMIDSEIRFHIPSWNVSELPVDSYSQDSGYTSE
SRPEASPMKHDSITSPGSLALEILPSGRKFWSDSPKGVGGNSPYRAGSSNFCSAADANAA
DGSLAANGDISADDRVGDCSDEKECDEIVDSPSSEKSIKSGATSEKSAVNVISGTVKDSE
AEYINLIATKLENLLVKQREELDELKRKHKLAVSDLLKELSPEISQKVLNICNLQMPGGE
VKGEAPASFI
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgctgccggattcctccgagcaggacctcgacgatcctgacatggaattcgtcgaggtg
gatccctctggtcgttatggtcggtacaaggaagttttagggaaaggggctttcaagaaa
gtatatcgagcgtttgatgaattggaaggtattgaagtggcttggaatcagattaagctg
gcggatgtgttacgtaactctgaagatttcgagcgactttattcggaggttcatttactc
aagactttgaagcataagaatataattaagttttataactcatggattgactctaagagc
gagaacatcaacttcattactgaaattttcacctcaggaacgttgcgccaataccggaag
aaacataagcatgttgatttgagagctgtgaagaaatggtctaagcagattctggaaggc
cttcactatcttcacagtaataatcctccgatcattcatcgtgacctgaagtgtgataac
atttttgtcaatgggaatcaaggggaggtaaaaattggtgatttaggattggcggctatc
ctccagcaggccaattcagctcacagtgtcataggaactccggagttcatggccccagaa
ctttacgaagaggaatacaacgagcttgttgacatctatgcttttggtatgtgcttgcta
gagttggtaacagttgagtacccgtatgttgaatgtgccaatgccgctcaaatatacaag
aaagtgacatctggaataaagccagcatcattggcaaaagtgacagatcctgaagttaaa
gcatttattgaaaagtgtattgctcatgtatctgaacggttgtctgcgaaggacctcttg
atggatcccttccttcagtcagattatgataatgaaagtgtaggccgatcttcaaaagct
caaacccatcatttagcaaatatttctcataatcaagctattgttgtggatacttctgct
gaggcaagtagggaattcacggtggaaggtcagaggagagataataatacaatattttta
aaattgagaattgcagattcctcaggtcatattcgcaatatccactttccttttgatatc
gaagcagacacttcaacctctgttgccagtgaaatggttgaggagttggaactaactgat
caagatgttacaactattgctaggatgattgactctgaaattcggtttcacattcctagt
tggaacgtcagtgaacttcctgttgacagttatagtcaagattcaggctatacctctgaa
agtaggccagaggcctctcctatgaaacacgattccattacttctcctggcagtcttgca
ttagaaatattaccttcaggtcgaaagttctggtctgactcgccaaagggagttggtgga
aactctccatatcgtgctggttcttcaaacttttgttctgctgcagatgcaaacgctgcg
gatggtagtctggccgcgaatggtgatatttcagcagatgatcgtgttggtgattgtagt
gatgagaaggagtgtgatgagattgttgattccccttccagtgaaaaaagtattaaatca
ggtgcaaccagtgaaaaatctgctgtgaatgtaatatctggaaccgtgaaagattcagaa
gcagaatacatcaatctcatagcaacaaaactggagaatttgttggttaaacaaagagag
gagttagatgaattaaagaggaagcacaaattagctgtctcagatcttttgaaggaactt
tctccagaaattagccagaaggttctaaatatatgcaacctacagatgcctggcggtgaa
gtgaagggagaggctcccgcttcattcatctaa

DBGET integrated database retrieval system