KEGG   Vigna angularis (adzuki bean): 108332541Help
Entry
108332541         CDS       T04660                                 

Definition
(RefSeq) polyamine oxidase 1
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00330  Arginine and proline metabolism
var00410  beta-Alanine metabolism
var01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    108332541
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108332541
Enzymes [BR:var01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     108332541
    1.5.3.16  spermine oxidase
     108332541
    1.5.3.-  
     108332541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_3 Thi4 Pyr_redox_2 FAD_binding_3 NAD_binding_9 FAD_binding_2 Shikimate_DH Pyr_redox FMO-like HI0933_like FAD_oxidored MCRA GIDA AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 108332541
NCBI-ProteinID: XP_017423342
UniProt: A0A0L9UIT6
Position
5
AA seq 514 aa AA seqDB search
MDSPPRSAVIIVGAGISGIAAAKVLVENGVKDVVILEASDRVGGRIRKESFGGVSVELGA
GWIAGVGGPLSNPVWELAAKFGIRTCFSDYSNARYNIYDRSGNIIPSGIAADSYQKAVDS
AIQMLRNQEEEEGEEEKANHGHGHGDDRFNSNRNNNESKRPSTPETPVELAIDFLLHDFE
MAEVEPISTYVDFGEKEFLVADERGYDHLLFKMVEEFLFTSEGRVLDNRLKLNKVVRELQ
YSKSGVTVKTEDGCVYEANYVILSVSIGVLQSDLLAFNPRLPRWKLEAIEKCDVMVYTKI
FLKFPYKFWPSGPEKEFFIYAHERRGYYTFWQHMENAYPGSNILVVTLTNAESKRVEAQP
DEETLREAMAVLRDMFGSDIPDAIDILVPRWWNNRFQKGSYSNYPIISNHKVFHNIKAPV
GRIFFTGEHTSERFNGYVHGGYLSGIDTSKALLEEMKKEKERNSESQTLLLEPLLAFTGS
LTMPKAETVSNIHKCDIPTQLYLTGNLGRQEAIL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggattctccccctcgctccgccgtcatcatagtcggtgccggaatctccggtattgct
gcggccaaggtgttggtggagaacggcgtcaaggacgtggtgattctggaggcgtcggat
cgcgtcggcggcaggatccgcaaggagagtttcggcggcgtgtcggtggagcttggagcc
ggttggatcgccggcgtcggcggtcccctgtccaaccccgtttgggaactcgccgcgaaa
ttcggcatccgcacttgcttctccgactacagcaatgcgcgctacaacatctacgaccgc
agcgggaacatcattccgagtggaatcgctgctgactcgtaccaaaaagcggtggactcg
gcgattcagatgttgaggaatcaggaagaagaggaaggagaagaagaaaaagcaaatcat
ggtcatggtcatggtgacgaccgttttaatagtaatagaaataataacgaatcgaaacgg
ccttcgacgccggaaacgccagtagagctcgcaattgatttcctcctgcatgatttcgaa
atggctgaggtagaaccaatatccacctatgtagactttggtgagaaagaatttttggtt
gctgacgaaagaggctacgaccatttgctgttcaaaatggttgaagaatttctcttcaca
tcggagggtagagttttggataatcgcctcaaactaaacaaggttgtccgggaattgcag
tattcaaaaagtggcgttacagtgaaaacggaggatggttgcgtttacgaagccaattac
gtgattctgtctgttagcattggtgttctccaaagcgacctactcgccttcaatccacgc
ttacccaggtggaaattggaagccatcgagaaatgtgatgtgatggtgtacactaaaatc
tttctgaagtttccgtataagttctggccaagtggacccgaaaaggaattcttcatctat
gctcacgagcggagaggctactacacattttggcagcacatggagaacgcctatcctggc
tccaatatcctagtcgtgacattgactaacgcggaatcaaaacgtgtggaagctcaacct
gatgaagagaccttgagagaagctatggcagtgctcagggatatgtttggatcagacatc
cctgatgccattgatatactcgttcctcgctggtggaataacaggtttcagaaagggagc
tacagcaactaccccatcatttccaatcataaagtttttcataatattaaggcccctgta
ggtcgcattttcttcactggggagcacactagtgaaagatttaatggctacgtacacggt
ggatacctctcaggtatcgacaccagcaaagcgttactggaagaaatgaaaaaggaaaaa
gaaagaaatagtgagagccaaactctgttgttagagcccttgctcgcttttacaggatct
ttaacaatgcccaaagcagaaactgtctccaatatccacaagtgcgatattcctacacaa
ttatacctcactggcaatcttgggaggcaagaggccatcttgtaa

DBGET integrated database retrieval system