KEGG   Vigna angularis (adzuki bean): 108334436Help
Entry
108334436         CDS       T04660                                 

Definition
(RefSeq) internal alternative NAD(P)H-ubiquinone oxidoreductase A2, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
var  Vigna angularis (adzuki bean)
Brite
KEGG Orthology (KO) [BR:var00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108334436
Enzymes [BR:var01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     108334436
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 108334436
NCBI-ProteinID: XP_017425772
UniProt: A0A0L9TKZ1
Position
1
AA seq 550 aa AA seqDB search
MALARIARANFRKSRGAYGSYASEKDLFKVGGYTTIRDTTSHVNFNSDEKFSYVPTNKEH
NCVNFAMRGISGTPYHQFPSANAQTVVEESESELENDQRRYAGLEATKPGEKPRVVVLGT
GWAACRFLKGLDTKIYDVVCISPRNHMVFTPLLASTCVGTLEFRTVAEPVTRIQDALAKD
PNSFFFLASCTGIDTGKHEVYCEAVNNGELPREPYEFKVAYDKLVIAAGAEALTFGIKGV
EENAFFLRDVNHAQEIRKRLLLNLMLSENPGIWEQEKKRLLHCVVIGGGPTGVEFSGELS
DFITRDVHERYTHVKDYIHVTLIEANEILSSFDVSLRQYATKHLTKSGVRLKRGVVKEVH
SKEIILSDGTKVPYGLLVWSTGVGPSKFVKALNLPKSPGGRIGVDEWLRVPSVEDVFALG
DCAGFLQQTGRPVLPALAQVAEREGKFLVELFNKIGKQNGGKAFSAKGTPLGEPFVYKHI
GSMASVGGYKALVDLRQTKDAKGLSLAGFVSWMIWRSAYLTRVLSWRNRLYVAVNWATTL
VFGRDNSRIG
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcattggcaaggattgctagggccaacttcagaaaatcaagaggtgcttatggtagt
tatgcgagtgagaaggatttattcaaagtgggaggatacacaaccatacgggacacaact
tcccatgtaaatttcaattcagatgagaagttttcatatgttccaacaaataaggaacat
aactgcgtgaactttgcaatgaggggaatatcaggaactccataccatcagtttccttct
gctaacgcacagacggttgttgaggagtcagagtcagagttggagaatgatcagcgtaga
tatgcaggactagaggcaacaaagccaggtgaaaagcctagggtggttgttcttggtacg
ggttgggctgcgtgtcgcttcctcaaagggcttgacaccaaaatctatgacgttgtgtgt
atatcaccaagaaatcacatggtttttactcctttgctggcttcaacatgtgttggaacc
ttggaattcagaactgttgctgagcctgtcaccagaatacaagatgcattagcgaaagac
cccaactccttcttctttttagcttcttgcacaggcatcgacactggaaaacacgaagtc
tattgtgaggcagtcaacaatggtgaattgccccgagagccttacgaatttaaagtcgcg
tatgacaagcttgtcattgcagcaggagccgaggctttgacttttggtatcaagggagta
gaggaaaatgccttttttcttcgtgatgtgaaccatgctcaagaaataaggaagagactt
ctcctgaatctgatgctttcagaaaatccaggcatatgggaacaagaaaagaaacgcctt
ctacactgtgtagttattggaggtggccctacaggagtggagtttagtggtgaattgagt
gatttcatcaccagggatgttcatgagcgttatactcatgtcaaagattacattcacgtt
acactaattgaggcaaatgagatactgtcatcctttgatgttagcctacggcaatatgca
acaaagcacttaacaaagtctggtgtccgtcttaagcgtggtgtagtgaaggaagtgcat
agcaaagagataattctgagtgatggaacaaaagttccttatggcctcttggtctggtcc
acaggagttggtccttcaaagtttgtgaaagccttaaatcttcctaaatctccaggcgga
agaataggtgtagatgaatggttgcgtgttccttctgtggaagatgtctttgcccttgga
gattgtgctggttttcttcaacaaactggaaggcctgtgcttccagctctagctcaggtt
gctgaaagggaagggaagtttcttgtggagctgttcaacaaaattgggaagcagaatgga
ggcaaggctttctctgcaaaagggacgccactgggagagccttttgtgtataagcatatt
gggagcatggcatctgtaggtggctataaagcactggttgatctacggcagacaaaggat
gcaaaggggctgtcacttgctggttttgttagctggatgatatggcgctctgcatatctt
acacgtgtccttagctggaggaacaggctttacgtggcagtaaactgggccaccacatta
gtctttggcagagacaatagtaggataggttga

DBGET integrated database retrieval system