KEGG   Vigna angularis (adzuki bean): 108336017Help
Entry
108336017         CDS       T04660                                 

Definition
(RefSeq) probable carotenoid cleavage dioxygenase 4, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00906  Carotenoid biosynthesis
var01100  Metabolic pathways
var01110  Biosynthesis of secondary metabolites
Module
var_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    108336017
Enzymes [BR:var01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     108336017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 108336017
NCBI-ProteinID: XP_017427781
Position
6
AA seq 587 aa AA seqDB search
MVPKPVIVTRPPPPVYSPPNPLLKTAVSTVKTEEKPQTTTLPPPSTTTPKTNPVPSIKTT
PQQRLELKRKTNSWAPAALMLNALDNIINNFIDPPLKPSLDPRHVLSQNFAPVDELPPTE
CQVVQGALPPCLDGAYIRNGPNPQFLPRGPYHLFDGDGMLHALRISQGKPTLCSRYVKTY
KYTMENDAGFPLIPNVFSGFNSLVASAARGSLSAARIVTGQFNPSNGIGLANTSLAFFGN
RLFALGESDLPYAVNVTSNGDVETIGRYDFNGKLTFSMTAHPKIDPDTGECFAFRYGPVP
PFLTYFRFDRNGNKYDDVPIFSMTSPSFLHDFAITKNYAVFCDIQLGMNPLDMIAGGSPV
GSVASKVPRIGILPRDAKDESKMKWFDVPGFNIVHAINAWEEDGGRTVVLVAPNVLSVEH
ALERMELIHAMVEKVKIDLETGIVTRQPVSARNLDFAVINPAFVGKKNRFVYAAVGDPMP
KISGVVKLDVSKANERRDCTVGCRMFGEGCYGGEPFFVAKEEGGEEDDGYLVTYVHDERK
RESTFLVMDTKSPELDVVAEVKLPRRVPYGFHGLFVKESDLRKTVSL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggtccctaaaccagtcatagtgacaagaccaccaccaccggtctattctccgcccaac
cctcttctaaaaaccgcagtatcaaccgttaaaacagaagaaaaaccccaaaccaccacc
cttcccccaccgtctaccaccactccgaaaacgaacccagttccatccatcaaaacgacg
ccgcagcaacgactggaactaaaaaggaaaacgaattcatgggcgccagcagcgctaatg
ctgaacgcgttggacaacatcatcaacaacttcattgaccctccgctcaaaccctcctta
gaccccagacacgtcctgtcccaaaacttcgcccccgtcgatgaactccctcccacggag
tgccaagtcgtccagggcgccctcccgccatgcctcgacggcgcgtacattcgaaacggc
ccaaaccctcagttcctcccgcgtgggccctatcacctcttcgacggcgacggcatgtta
cacgcgctacgcatatcccaaggcaaacccactctctgtagccgctacgtcaaaacctac
aaatacactatggaaaacgacgccggttttccactcatccccaacgtcttctccggcttc
aactccctcgttgcctccgcggcgcgtggctctctctccgcggcgaggatcgtcaccgga
cagttcaatccttctaatggcattgggttggccaacaccagcttagccttcttcggtaac
cgtctcttcgcgttaggcgaatccgacctcccctacgctgtcaatgttaccagtaacggc
gacgtcgaaacaatcggccgttacgacttcaacggcaaacttacgttcagcatgacggcg
catccgaagatagaccccgacacaggggaatgcttcgccttccgttacggccccgttccc
ccgttcctaacctacttccgttttgaccgtaacgggaacaaatacgacgacgtgcctatc
ttctccatgacttcaccttcgtttctccacgacttcgccatcaccaagaactatgcagtc
ttctgcgacattcagctcggaatgaatcctctcgacatgatcgccggtggctcccccgtc
ggctccgtcgcttccaaggtcccaaggatcggaatccttcctcgtgatgctaaggacgaa
tccaagatgaagtggttcgacgtgccggggtttaacatagttcacgcgataaacgcgtgg
gaagaggacgggggaagaacggtggtgctggttgcgccaaatgttctgtcggtggagcac
gcactggaaagaatggagctgattcacgcgatggtggagaaggtgaagatcgatctggag
acggggattgtgacgcggcaaccggtgtcggcgcggaaccttgatttcgcggttataaac
ccggcgttcgttgggaagaagaacaggttcgtttacgcggcggtgggcgacccgatgccg
aagatctcgggggtggtgaagctggacgtgtcgaaggcgaatgagcggagggactgtacg
gtgggatgcaggatgttcggcgaggggtgctacggcggggaaccgttcttcgtggcgaag
gaggaagggggtgaggaggacgatgggtacttggtgacgtacgtgcacgacgagaggaag
agagagtcaacgttcttggtgatggacacgaagtcgccggagctggacgtggtggcggag
gtgaagcttccacggcgggttccgtacggttttcatggtttgttcgtgaaggaaagtgat
cttaggaaaacggtgtcgttgtga

DBGET integrated database retrieval system