KEGG   Vigna angularis (adzuki bean): 108337328Help
Entry
108337328         CDS       T04660                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00052  Galactose metabolism
var00500  Starch and sucrose metabolism
var01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:var00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    108337328
   00500 Starch and sucrose metabolism
    108337328
Enzymes [BR:var01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     108337328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 108337328
NCBI-ProteinID: XP_017429318
Position
7
AA seq 577 aa AA seqDB search
MKIIAELLLFVVVSFLLNSGNGIQAFSTHSINSRATAKQPYRTSYHFQPQENWMNDPNGP
MYYKGVYHLFYQHNPEAATFGDRIVWGHSVSYDLINWIHLNNAIEPSGPYDINSCWSGSA
TIIPGKEEPMILYTGIDDKKHQVQNLAVPRNLSDTFLREWIKHSQNPVMTPPRGVEVDNF
RDPSTAWQGKDGKWRVVVGAQNGDEGKAILYQSKDFVNWKVDPNPFYASQNTGVCECPDF
FPVYINGSTDGVETSAQNPSVRHVLKISYLRKQHDYYFLGNYASDQGNFIPDVRFTGTSS
DLRYDYGKFYASKSFFENAKNRRILWGWVNESDSTQDDIQKGWAGLQTIPRQVWLDKSGK
RLVQWPLEEVEQLRGKHIRITRENLEHGSNLEVSGITASQADVEVLFELPELEKAEFLDP
NGVDPQLLCSQEYAARSGTIGPFGLLALASKDLKEHTAVFFRIYRASNGYVCLMCSDQSR
SSLRHDLDKTTYGSILDIDPNLKTISLRSLIDHSIVESFGDGGRVCITSRVYPSLAIDKD
AHLYVFNYGSQSLVVSELNAWSMKQAEIGYEGNISYT
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcattgcagagctactgttatttgttgttgtttcttttctgctcaacagtgga
aatggaattcaagcattctccacacatagcatcaattctagagcaactgcaaagcaacct
tatagaacttcttatcactttcagccccaagaaaattggatgaacgatcccaatgggcct
atgtactacaaaggtgtttaccaccttttctatcagcataaccctgaagcagcaaccttt
ggtgataggattgtgtggggtcactcagtatcctatgatctcatcaattggattcatctg
aataatgctattgaaccaagtggaccatatgatattaatagctgttggtcaggctcagcc
actataatccctgggaaagaagagcctatgattttgtacacgggaattgatgataagaaa
catcaagttcagaacttagctgtgccgaggaatctatctgacaccttcttaagggaatgg
ataaaacactctcagaaccctgtgatgactccaccaagaggagttgaagttgataatttc
agagacccttcaactgcttggcagggaaaggatgggaaatggagggtagtagttggtgcc
caaaatggtgatgaagggaaggcaattctctaccaaagtaaggattttgttaattggaaa
gtggatcctaatcccttttatgcatcacaaaatactggggtttgtgagtgtccagacttt
tttcctgtgtacatcaatggcagcacagatggggtggaaacttctgcgcaaaatccaagt
gtcagacatgtcttgaagataagctacctacgcaagcagcatgattactattttcttggt
aactatgcatctgatcagggaaacttcattcctgatgtcaggtttacagggactagttca
gacttgaggtatgactatggtaaattctatgcttccaagtcattttttgaaaatgccaaa
aacaggagaatattatggggatgggtgaacgaatctgactccacacaagatgatattcag
aaaggatgggctggtctacagacaattccaaggcaagtttggcttgataaaagtgggaag
cgattggttcaatggccacttgaagaggtagaacaactacgtggcaagcacatcagaata
acgagggagaaccttgagcatggatcaaatcttgaagtctcgggtatcactgcatcacag
gccgatgtagaagtgttgtttgagctacctgagctagaaaaggctgagtttcttgatcca
aatggagttgatccccaactactttgtagccaagaatatgcagcaagaagtggcacaata
gggccatttgggttgttagctttggcttcaaaggatctcaaagagcacaccgcagtcttc
ttcagaatttatagagcatccaatggatatgtatgcctcatgtgcagtgaccaaagcagg
tcctcattgaggcatgaccttgacaaaactacatatggaagtatcttagacatagatccc
aatctaaaaacgatttcactaagaagcttgattgaccactccattgttgagagttttgga
gatggagggagagtttgtatcactagcagagtttatccatcattggctatagacaaagat
gctcatctttatgtatttaactatggaagccagagtttggtggtttcagaactgaacgct
tggagcatgaaacaagcagagattgggtatgagggaaacataagctatacctga

DBGET integrated database retrieval system