KEGG   Vigna angularis (adzuki bean): 108339814Help
Entry
108339814         CDS       T04660                                 

Definition
(RefSeq) beta-fructofuranosidase, soluble isoenzyme I-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00052  Galactose metabolism
var00500  Starch and sucrose metabolism
var01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:var00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    108339814
   00500 Starch and sucrose metabolism
    108339814
Enzymes [BR:var01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     108339814
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 108339814
NCBI-ProteinID: XP_017432515
Position
8
AA seq 636 aa AA seqDB search
MNTDPKTPLLSPPSSITRKNEGRTQKGVLIFIVSIVFLMSLAALVISLHSHNIQPLLSII
QKPLTIEINLRSLPLQPRGIAEGVSAKSNPYLWQIGSYNWTNAMLSWQRTAFHFQPQKNW
MNDPNGPLFYKGWYHLFYQYNPDSALFANITWGHAVSRDLIHWLHLPIAMLRDSWYDING
VWSGSATLLPDGKIVMLYTGSTHQNVQVQNLAYPANLSDPLLIHWVKYSDNPLLVPPPGI
GPKDFRDPTTAWIGPDGKWRIAIGSKVNQTGLSLVYKTQDFIHYELNDQYMHEVPGTGMW
ECVDFYPVSVNGSDGLDTSANGPDVKHVLKSSLDDTRGDHYAIGTYFSENDTWVPDNPDE
DVGIGLKLDYGRFYASKTFYDQYKKRRVLWGWINESDSETADLKKGWASLQSIPRTVVFD
NKTRAHLLQWPVEEIESLRLSSYEFEEVVVKPGSVLPLDIGPATQLDIFAEFEIEYLASK
ETEKKENVGCGNGAFDRSSLGPFGILAIADDQLSELTPIYFHLSSTTTSLTSSFCVDETR
SSKAPDVSKLVFGSEVPVVSDERLSMRILVDHSVIESFAQGGRTVISSRVYPTKAIYEAA
RLFVFNNATDINIKASLKIWQLNSAFIRPFPFDKKL
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgatccaaaaactccattgctgagtcctccaagttccataacaaggaaaaat
gagggaagaacacaaaagggtgtccttattttcattgtttccatcgtttttctcatgtca
ttggctgcacttgtcataagcctccatagccataacatccaacctttactaagtattatc
cagaagcctctcacgatcgagatcaacttaaggtctctaccattacagcctcgaggtatt
gcagaaggtgtttcagcaaagtcaaatccatatctatggcagataggttcatataactgg
acaaacgccatgttatcgtggcaaagaacagcttttcattttcaacctcagaagaactgg
atgaacgatcctaacggtccattgttttacaaggggtggtaccatttgttttaccaatac
aatcctgattcagctctgtttgcaaacataacgtggggccacgccgtatcaagggacttg
attcactggctccatcttcccattgcgatgcttcgagattcctggtacgatatcaacggt
gtatggtcaggatcggccacgcttttgccagatggcaaaatcgtcatgctctacactggt
agcacccatcagaacgtgcaagtccaaaatcttgcgtaccccgccaatctatctgatccg
cttctcattcattgggtcaagtactctgataacccactcttggtgcctccaccgggaatt
gggcccaaggattttcgtgacccaactactgcgtggattgggcctgatggcaaatggagg
atcgctattgggtcaaaggtcaaccagacaggtctttcgttggtgtataaaacccaagat
tttatccactacgaactcaatgatcagtacatgcatgaggtcccgggtacgggtatgtgg
gagtgcgtggacttttacccggtttcggtaaatgggtcggatgggttggatacatctgca
aatgggccagatgtgaaacatgtgttgaagtctagtttggatgacactaggggggatcat
tatgctattgggacgtacttcagtgaaaatgatacgtgggtgcccgataacccggatgag
gatgtgggtatcgggttgaagttggactatgggagattctatgcgtcaaagacgttttat
gaccaatacaaaaagagaagggtcttgtggggttggatcaacgaatcagacagcgaaacc
gctgacttgaaaaagggttgggcatctcttcagagtattccaagaacagtggtgtttgac
aataaaactagagctcatttgcttcagtggccagtggaagaaatagagagcttaaggctt
agcagttatgaatttgaagaagtcgtggttaagccgggctcagttctgccattggacata
ggccctgccacacagttggacatatttgctgaatttgaaatcgaatatttagcatccaaa
gagaccgagaagaaggaaaatgtagggtgtggaaatggagcttttgacagaagtagtctg
ggaccatttggcattctggctattgcagatgaccaactttctgagctaacaccaatttat
tttcatctttctagtactaccaccagtttaacatcttccttctgtgttgatgaaaccagg
tcttcaaaggctcctgatgtttcaaaactcgtttttggaagcgaagttccagtcgtcagt
gatgaaagattatcaatgaggatattggtggaccattcagtcattgagagctttgctcaa
ggagggagaactgtgatatcgtctagagtttatccaacaaaagcaatttacgaagctgca
agattgtttgtgttcaacaacgcaacagacataaacatcaaggcctcactcaagatttgg
caattgaactcagcttttatacgtccctttccctttgacaagaagttgtga

DBGET integrated database retrieval system