KEGG   Vigna angularis (adzuki bean): 108341600Help
Entry
108341600         CDS       T04660                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 2-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00350  Tyrosine metabolism
var00360  Phenylalanine metabolism
var00380  Tryptophan metabolism
var00950  Isoquinoline alkaloid biosynthesis
var00965  Betalain biosynthesis
var01100  Metabolic pathways
var01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    108341600
   00360 Phenylalanine metabolism
    108341600
   00380 Tryptophan metabolism
    108341600
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    108341600
   00950 Isoquinoline alkaloid biosynthesis
    108341600
   00965 Betalain biosynthesis
    108341600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:var04147]
    108341600
Enzymes [BR:var01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     108341600
    4.1.1.105  L-tryptophan decarboxylase
     108341600
Exosome [BR:var04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108341600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 DUF1148
Motif
Other DBs
NCBI-GeneID: 108341600
NCBI-ProteinID: XP_017434754
UniProt: A0A0L9VES7
Position
9
AA seq 517 aa AA seqDB search
MNPLDPKEFRRQGHMIIDFLADYYQNIGKYPVLSQVEPGYLKNLMPEFAPLSPEPIETIL
QDLQQHIVPGITHWQSPNYFAYFPSSGSTAGFAGEMLSTGFNLVGFNWVSSPAATELESI
VMDWLGQMLNLPKAFLFSGSGGGVLLGTTCEAILVTLVAARDKMLSQIGRESICELVVYV
SDQTHCAVQKAAHIIGIHPKNIRVIKTIKSTSFTLSPESLSSTIQTDVQNGLVPCYLCVT
VGTTSTTAIDPLGPLCMVAKKYGMWVHVDAAYAGSVCVCPEFRHFIDGIENANSFSFNAH
KWFLTNLDCCCLWVKDPASVIKSLSTHTVYLENSATDSKRVVDYKDWQITLSRRFRALKL
WLVLKSYGVVNLRNFLRSHVEMAKTFEGLVKRDKRFEIFVPRNLAVVCFRLLPSAVAKIS
NGGSKTEDVAKISNGGSKTENVAKISNGGIKLEDVAHGINRRLLDSINGSGTVYMTHAVV
GGVFVIRCAIGATLTHTTHVIMAWKTVQEHADAVLNY
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctttagacccaaaagaatttaggaggcaagggcacatgatcattgacttcctt
gctgattattaccagaatattggcaagtatccagtgttaagccaagtagaaccaggttac
cttaaaaatctcatgccagaatttgcccctctcagtcctgaaccgattgaaaccattctt
caagatttgcagcagcacatagttcctggcataacacactggcaaagccctaattacttt
gcctactttccctccagtggtagcacagcagggtttgctggtgagatgctgagcacagga
ttcaacttggtaggcttcaattgggtgtcatcaccggctgcaacagagctagaaagtatt
gtcatggattggctaggccagatgctgaatctccccaaggcttttctcttctcagggagt
ggtggaggtgtgttgttggggacaacatgtgaggccattctggtcacacttgttgctgct
agagataaaatgcttagccaaattggcagagaaagtatctgtgagcttgtcgtttatgtg
tctgatcaaacacattgtgctgttcagaaagcagctcatataataggaattcaccctaaa
aatattagggtaatcaagacaataaagtcgacttccttcactctttcaccagaatcacta
tcatccaccattcaaacagatgttcaaaatgggttggttccttgttatctttgtgtcact
gtgggcacgacttcaaccactgctattgatccattgggaccactgtgcatggttgcaaaa
aaatatggcatgtgggttcatgttgatgctgcttatgctggtagcgtgtgcgtttgtcct
gagttcagacacttcattgatggaattgagaatgcaaactcgttcagtttcaatgctcat
aaatggtttcttactaacttagattgttgctgcctttgggtgaaggatccagcttctgtg
ataaagtccctatcgacacatacagtgtacttggagaacagtgctaccgattcaaaacga
gtggtggactacaaggattggcagataaccttgagcagaagattccgtgcactcaaactt
tggctcgttctaaaaagctatggtgttgtcaatctcagaaacttcctcagaagccacgtt
gaaatggccaagacttttgaagggttggtgaaaagggacaaaaggtttgagatttttgtg
cctagaaatcttgctgtggtttgctttaggcttttaccttcagcagttgcgaagatcagc
aatggaggttccaaaactgaggatgttgcaaagatcagcaatggaggttccaaaactgag
aatgttgcaaagatcagcaatggaggtatcaaacttgaggatgttgcacatggaatcaac
cgtaggttgctggattcgatcaatggttcgggcactgtttacatgactcatgcagtcgtt
ggaggggttttcgtgattaggtgtgccattggagcaacccttactcatacaacacacgtt
atcatggcatggaagacggtgcaagaacatgcagatgccgttctaaattactga

DBGET integrated database retrieval system