KEGG   Vigna angularis (adzuki bean): 108343523Help
Entry
108343523         CDS       T04660                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00010  Glycolysis / Gluconeogenesis
var00562  Inositol phosphate metabolism
var01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108343523
   00562 Inositol phosphate metabolism
    108343523
Enzymes [BR:var01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     108343523
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     108343523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 Ndc80_HEC
Motif
Other DBs
NCBI-GeneID: 108343523
NCBI-ProteinID: XP_017437345
UniProt: A0A0L9VAE6
Position
9
AA seq 494 aa AA seqDB search
MSNSIMAFALLLFLWLIGYSNAEEDFDVRKHLSTVSRYGAVKDIADNNFVPSKIPEGCVP
IHLNLVARHGTRSPTKKRIKKLDNLSAHLEDLVRDAKERNLPLERVPSWLNGWKSPWQGR
LRGGELISKGEEELYDLGIRIRAKFPNLFDEEYHPDVYPIKASQIPRASASAVAFGMGLF
RGNGSLGPGRHRAFAVTSESRASDILLRFHDCCHNYKAYRKNQEPAVSKLKEPILDEITS
ALIGRHYLNFTREDTSSLWFLCKQEASLLDITNQACGLFIPSEIELLEWTDDLEMFILKG
YGKSLNYRMGVPLLEDVFQSMEQAIIAKEEKHASGSFEKARLRFAHAETLVPFSCLLGLF
LEGSEIKKIQKEQPLQQPPMPPQKRKWRGSTVAPFAGNNMLVLYSCSAPDKSISKHFVQV
LHNEHPIPLPGCDGSDLCPFELFKEKIVAPHQRHDYHKVCNPKLEHEPSGSKFFQIFQWL
FSSAKGDNYSKDEF
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattctatcatggcctttgctctgctattattcctttggttgataggctattca
aacgccgaagaagatttcgatgttcgcaagcacctctccactgtgtctagatatggtgcc
gtgaaagacattgctgacaataacttcgttccttctaaaatcccggagggatgtgttccg
atccatttgaatcttgtggctaggcatggaactcgttctcccacgaagaaaaggataaag
aagttagataatttgtctgctcatctggaagatcttgtgagggatgcaaaagagcgaaat
ttgcctttggagagggttccttcctggctgaatggatggaaatctccttggcagggaagg
cttaggggtggtgaattaattagcaaaggagaggaagaattatatgatcttggaatcagg
attagagccaagtttccaaatttgtttgatgaagaataccatcctgacgtatatcctatt
aaggcatctcagattccccgagcatctgccagtgctgtggcatttggtatggggcttttc
agaggcaatggaagtcttggacctgggcgtcatcgagcctttgctgttacaagtgaaagc
cgtgctagtgacatactgctgagatttcatgactgctgtcataattacaaggcttatcgg
aaaaaccaggaacctgcagttagtaaacttaaggaacccattttggatgagattacatct
gcactgattggacgccattaccttaattttaccagggaggatacatcttctctctggttt
ttgtgtaaacaggaggcatccttgttggatataactaatcaagcgtgtggtctgttcatc
ccttctgagattgaattgcttgagtggacagatgatttggagatgtttattctgaaaggt
tatggtaaatcactaaactatagaatgggagtgccattacttgaagatgtttttcaatcc
atggaacaggctatcatagctaaagaagaaaaacatgcttctggcagctttgaaaaggca
agacttcggtttgcgcatgctgaaaccttagttccattctcatgtctccttggtttattt
cttgaaggatctgagattaaaaaaattcagaaggaacaacctctacagcagcctccaatg
cctccacagaaaagaaaatggcggggtagcactgtagccccttttgctggtaacaacatg
ctggtcttgtatagttgttctgctccagataaatctataagcaagcactttgtgcaggtg
ttacacaatgaacaccccattccattgccaggttgtgatggctctgatctctgcccattt
gaactattcaaggaaaaaattgttgcaccacatcagaggcatgactaccataaagtctgt
aatccaaagctagagcatgagccctcgggcagcaagttttttcagatatttcagtggctt
ttctcatcagcgaaaggtgataactactcgaaagatgaattttag

DBGET integrated database retrieval system