KEGG   Vigna angularis (adzuki bean): 108344900Help
Entry
108344900         CDS       T04660                                 

Definition
(RefSeq) sirohydrochlorin ferrochelatase, chloroplastic
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00860  Porphyrin and chlorophyll metabolism
var01100  Metabolic pathways
var01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:var00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    108344900
Enzymes [BR:var01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     108344900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CbiX CbiK
Motif
Other DBs
NCBI-GeneID: 108344900
NCBI-ProteinID: XP_017438922
UniProt: A0A0L9VQ99
Position
10
AA seq 208 aa AA seqDB search
MKSLSVQSYAFFCSFSSNETGTNPRCLPIKSSNSICCSSKPRNLSGFLCLSTPNGGFREN
SGAVGRGDAVIIVDHGSRRKESNLMLNEFVEIFKYKTGYEIVEPAHMELAEPSIRDAFQS
CVQQGANRIIVSPFFLSPGRHWSQDIPSLSAEAAKEHPDVSYIVTAPLGLHELLVDVVND
RIKHCIKHVAGDADECSVCAGTGKCRLY
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctctctcagttcaatcttatgccttcttctgtagtttttcttcaaatgaaact
ggaacaaaccctagatgtctgcccatcaagtcatcaaattctatctgctgttcttccaag
cctcgaaatttgagtggatttttgtgtctgagcactccaaatggtggcttcagagaaaac
tctggtgcagttggtcgtggagatgcagtgataattgtggatcatggttcgcgtcgcaaa
gagtccaatttgatgcttaatgagtttgtggagatatttaagtataaaactggttatgag
atagtggagcctgctcacatggagttagcagagccatcaataagagatgcttttcaatct
tgcgttcaacaaggtgcaaatagaattattgttagtcccttttttctctctcctggaagg
cattggagtcaggacattccttccttgagcgctgaggcagcaaaggaacacccagatgtg
tcgtacattgtaactgcacccctcggattacatgaactgcttgtggatgttgtgaatgat
agaatcaagcactgcataaagcatgtggctggagatgcagatgagtgttcagtctgtgca
gggactggaaaatgcaggctctattag

DBGET integrated database retrieval system