KEGG   Vigna angularis (adzuki bean): 108347446Help
Entry
108347446         CDS       T04660                                 

Definition
(RefSeq) probable protein S-acyltransferase 5
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
var  Vigna angularis (adzuki bean)
Brite
Enzymes [BR:var01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     108347446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Ion_trans
Motif
Other DBs
NCBI-GeneID: 108347446
NCBI-ProteinID: XP_017442216
UniProt: A0A0L9TJ34
Position
1
AA seq 438 aa AA seqDB search
MSLPPPPANSDSANTSAPSLVRTYRVWQGSNVFLFGGRLIFGPDVKSIFISVFLIIVPIA
VFCGLVARKLLDDFPHHSGWSIMGVVIALTLFVLTTLIVTSGRDPGIVPRNAHPPEPDDY
NWTENSNNGQISTSRFPRTRDVIVNGITVKVKYCDTCMLYRPLRASHCSVCDNCVERFDH
HCPWVGQCIGLRNYRFYYMFVFSATLLCLYVHAFCWVYIVRIKDFEKISIWKAMSKTIAS
TALIIYTFVCVWFVGGLAVFHTYLISTNQSTYENFKYRYDPQTNPYNRGIFNNFKEVLCS
RIPPSKNNFRSKVPREPLDSYRRTDIRPLSPLMKRTTRHMELLVGNSVYNEHEEEESHHR
DGSENEARSKDSESKDSGLTDKSVDLSRIFHTEGVEGQESSVGRQPPWETTPQVPDSIIE
VGESNWTTGPRYSTQETV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttgccgccgccgccggcaaattcagattccgccaatacctccgctccgtcgttg
gtcagaacttatcgcgtctggcaaggcagtaacgtttttcttttcggagggagactcata
tttgggcctgatgtgaaatcaatatttatatcagtttttcttattattgttcccatcgcg
gtgttctgtggtttggtagcgaggaaattgttggatgattttcctcatcactctggatgg
tcaataatgggtgtggttattgctctcacactgtttgttctaaccacccttatagtaacc
tcaggaagagatcctggcatagtacctcgtaatgctcatcctccggagccagatgactat
aattggactgagaatagcaacaatgggcaaatttcaacgtcacgatttccacggacaagg
gatgtaattgtaaatggtataacagtgaaagtcaaatattgtgatacttgcatgctctac
agacccctccgtgcttctcactgttcagtctgtgataactgcgtagagcgatttgatcat
cactgcccatgggtgggtcagtgtattggactgcgaaattaccggttctactacatgttt
gttttctcagccactctgctttgcttgtatgtacatgccttttgctgggtttacattgta
aggatcaaggacttcgagaaaatatcaatttggaaagcaatgtccaaaactatagcatcc
actgcactaataatctacaccttcgtttgtgtctggtttgttggcggcctcgctgttttc
cacacgtacctcatcagcacaaaccagtctacttacgaaaattttaaataccggtatgac
cctcaaaccaacccatacaacagaggtatatttaacaacttcaaagaagtgttatgctct
aggattcctccgtccaagaacaatttcaggtctaaggttccaagggagccattagattca
tatcgaagaacggacatcaggcccttaagcccattgatgaaaagaaccaccaggcatatg
gaattattagttggaaattcagtttataatgagcatgaagaggaggaaagtcatcataga
gatgggtctgagaatgaagcacgtagcaaggatagtgaaagcaaagacagtggattgacc
gataagtccgtggatttaagcaggatctttcacactgaaggagtagagggccaagaaagt
tcagttggtagacaacctccatgggaaacaactccacaagttcctgatagcataatcgaa
gtcggggaatcaaattggactactggacccagatactccactcaagagactgtatag

DBGET integrated database retrieval system