KEGG   Veillonella atypica: B7L28_06290Help
Entry
B7L28_06290       CDS       T04798                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
vat  Veillonella atypica
Pathway
vat00020  Citrate cycle (TCA cycle)
vat00620  Pyruvate metabolism
vat00650  Butanoate metabolism
vat01100  Metabolic pathways
vat01110  Biosynthesis of secondary metabolites
vat01120  Microbial metabolism in diverse environments
vat01130  Biosynthesis of antibiotics
vat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B7L28_06290
   00620 Pyruvate metabolism
    B7L28_06290
   00650 Butanoate metabolism
    B7L28_06290
Enzymes [BR:vat01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     B7L28_06290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF
Motif
Other DBs
NCBI-ProteinID: ARF99610
Position
complement(1378952..1380454)
Genome map
AA seq 500 aa AA seqDB search
MIDIKDRVKNAALQGKIVTAYEAAQMINHNDKVGISGFTPSGYAKAVPLALAERMEKEPF
KIDLWTGASVGDEADGALTRAHGINRRFPYQTNGDTRKALNSGDIKYVDMHLSTMAQNVR
YGFFGDLDVAIVEVCQINEDGSLVPTTSVGNSPTFVSQAKKVIVEVNVSQPLTLVGMHDI
YEPLDPPYRKPIPLEHAGDRIGTDAIPCDPDKIIAVVPCDVPDTTRPLAPIDDDAKAMSQ
HLIKFFEQEIAEGRLPENLLPLQSGVGSVANAVISGLAQGPFKDLSIYTEVIQDGMFDLI
DAGKVTVCSGTALSPSPDGLKRFYNNIDEYRKKIILRPQEISNNPGIARRIGVIAMNTAI
EFDIFGNVNSTHIMGSKMMNGIGGSGDFARSAYLTIFCTNSVAKGGDISSIVPYVSHVDH
PEHDTMIFCTEQGVADCRGLSPVERARLIIEKCAHPDYKPMLTEYLEKALAATKNAHTPM
LLDEALSWHKRFTETGSMKK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgatagacatcaaagatcgcgttaaaaatgcggccctccaaggcaaaattgtcacagct
tatgaagcagctcaaatgattaaccacaatgataaagttggtatttccggctttactcca
tctggttatgcaaaagctgtaccattggctttggctgaaagaatggaaaaagaaccattc
aaaattgatttatggacaggtgcttctgtaggtgatgaagctgacggtgcattaacacgt
gcacatggtattaatcgtcgtttcccttatcaaacaaatggggatacacgcaaagcttta
aatagcggcgacatcaaatacgttgatatgcacttaagtacaatggcgcaaaatgtacgc
tatggtttctttggtgatttagacgtagctatcgtagaagtttgtcaaatcaatgaagat
ggctctttagtacctacaacatctgttggtaactctccaacatttgttagccaagctaaa
aaagttatcgtagaagtaaacgtatctcaacctttaactttggttggtatgcatgatatc
tacgaaccacttgatccaccatatcgcaaaccaattccattggaacatgctggtgatcgt
attggtactgatgcaattccttgtgacccagacaaaatcattgcagtagttccttgtgat
gttcctgatactacaagacctttggcacctatcgatgatgatgcaaaagcaatgagtcaa
caccttatcaaattctttgaacaagaaatcgcagaaggtcgtttacctgaaaacttgctt
ccattgcaatctggcgtaggttctgtagcaaatgcagtaatcagcggattggctcaaggc
ccattcaaagatttgtccatttatacagaagtaatccaagatggtatgtttgacttaatc
gatgcaggtaaagtaactgtatgttccggtactgcattaagtccttctccagatgggttg
aaacgtttctacaataacatcgatgaatatcgtaaaaagattattcttcgtccacaagaa
atttccaacaaccctggtattgctcgccgtattggtgtcattgccatgaataccgctatt
gaatttgatatttttggcaatgtaaactctactcatatcatgggtagtaaaatgatgaac
ggtattggcggatctggtgactttgcacgtagtgcatatctcactattttctgtactaat
tccgttgcaaaaggtggcgacattagttctatcgttccatatgtatctcatgtggatcac
ccagaacatgacactatgattttctgtacagaacaaggtgttgctgactgccgtggtttg
agcccagtggaaagagctcgtttgatcattgaaaaatgtgctcacccagactacaaacct
atgttaactgaatacctcgaaaaagcactcgctgcaactaagaatgcccatacaccaatg
ttgctcgacgaagctctttcttggcataaacgcttcacagaaactggaagcatgaaaaaa
taa

DBGET integrated database retrieval system