KEGG   Vibrio anguillarum NB10: VANGNB10_cI0316Help
Entry
VANGNB10_cI0316   CDS       T03657                                 

Gene name
dhfRIII
Definition
(GenBank) dihydrofolate reductase type 3
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
vau  Vibrio anguillarum NB10
Pathway
vau00670  One carbon pool by folate
vau00790  Folate biosynthesis
vau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VANGNB10_cI0316 (dhfRIII)
   00670 One carbon pool by folate
    VANGNB10_cI0316 (dhfRIII)
Enzymes [BR:vau01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     VANGNB10_cI0316 (dhfRIII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: CDQ49234
UniProt: A0A1Y0P430
Position
1:384706..385188
Genome map
AA seq 160 aa AA seqDB search
MIISMIAAMADNRIIGKNNQMPWHLPADFAWFKRCTLGKPVIMGRKTYESIGRPLPGRHN
IVISRDASLAIEGVSIVSSIEEAIEVAGHVDEVMIIGGGSIYQACMPQANKLYLTFIDLN
IEGDTQFPEWGSEWQEVHREMYQADDKNAHNMQFVVFDKQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcagcatgattgccgcgatggcagacaaccggattattggtaaaaataatcaa
atgccatggcatttaccggcagattttgcatggtttaaacgctgtacgttgggcaaacca
gtgatcatggggcgaaaaacttatgagtctattggtcgcccgttacctggtcgccataat
atcgtgatcagtcgtgatgcttcattggcaattgaaggggtgagtattgtctcttcgatt
gaagaagccattgaggttgcgggtcatgtggatgaagtgatgatcattggtggcggctct
atctatcaagcctgtatgccacaggccaataaactatacctcacctttattgacttaaat
attgagggagatacgcaatttcccgagtgggggagtgagtggcaagaagttcatcgagaa
atgtatcaagcggatgataaaaatgctcacaacatgcagtttgtggtttttgataagcaa
tag

DBGET integrated database retrieval system