KEGG   Vibrio anguillarum NB10: VANGNB10_cI1185Help
Entry
VANGNB10_cI1185   CDS       T03657                                 

Gene name
oadA-2
Definition
(GenBank) Oxaloacetate decarboxylase, alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
vau  Vibrio anguillarum NB10
Pathway
vau00620  Pyruvate metabolism
vau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VANGNB10_cI1185 (oadA-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vau02000]
    VANGNB10_cI1185 (oadA-2)
Enzymes [BR:vau01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     VANGNB10_cI1185 (oadA-2)
Transporters [BR:vau02000]
 Other transporters
  Primary active transporters [TC:3]
   VANGNB10_cI1185 (oadA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: CDQ50099
UniProt: A0A1Y0NY98
Position
1:1399785..1401581
Genome map
AA seq 598 aa AA seqDB search
MSNNNKPLGITDVVLRDAHQSLFATRLRLDDMLPIASELDQIGYWSLETWGGATFDSCIR
FLGEDPWHRLRELKKAMPNTKQQMLFRGQNILGYRHYADDVVDKFVERAVVNGMDVFRVF
DALNDVRNMKQAIQSVNKYGAHAQGTICYTTSPVHTMQSWVDVAEQLVECGVQSIAIKDM
AGVMTPYEASELVSTLKKQLDIELHLHCHSTAGLADMTLLKAIEAGVDRVDTAISSMSGT
YGHPCTESIVAALKGTGRDTGLDIYKLESIAAYFREIRKKYHAFEGQLKGADSRILVAQV
PGGMLTNMESQLKQQNALDKIDEVLKEIPRVREDLGFIPLVTPTSQIVGTQAVINVMMGE
RYKTITKETAGVLKGEYGQTPAPVNAELQAKVLKGAAAITCRPADLIEPEINTLSLSVQA
QAKERNISLVEEVIDDVLTIALFDQVGWKFLENRMNPAAFEPKPCIAEVKAPVVACKEEQ
AIYTVSVNNQSYVVQINEGGDPQVLATASNVSPKAAAASASPSAPSGNAETVAAPLAGNI
WKIHTKVGDVVEEGQVLLILEAMKMETEIRAARDGIIEKLSVSEGDSVQVGDALMALA
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgtctaataacaataaaccacttggcatcaccgatgtcgttttgcgcgatgcgcatcaa
tctctttttgctactcgcttacgtcttgatgacatgttacccatcgcatcggaacttgat
caaattggttactggtccttggaaacgtggggcggagccacgttcgattcatgcatccgc
tttttaggggaagacccatggcatcggttgcgcgagcttaaaaaggcgatgccaaatacc
aagcaacaaatgctatttagaggacagaacatccttggctatcgccattatgctgatgat
gttgttgataaatttgttgagcgtgctgttgtcaacggaatggacgtatttcgtgtgttt
gatgcattaaacgatgtacgcaacatgaaacaggccattcagtccgtcaataagtatgga
gctcatgctcaaggcaccatttgctataccacgagcccagttcacaccatgcaatcttgg
gttgatgtggcggagcaattagtagagtgcggtgtgcaatccatcgcaatcaaagatatg
gcgggtgttatgacgccgtatgaagccagcgaattggtttctacactgaaaaaacagctt
gatatagagcttcatttacactgtcattcaacggcaggccttgctgatatgacattactg
aaggccattgaggctggagtggatcgcgttgatactgccatttcttcgatgagtggtact
tatggccatccttgtactgagtccatagtcgcggccttaaaagggacaggacgtgatacc
gggttagacatctacaaattagagagtatcgccgcttatttccgtgaaattcgcaaaaaa
tatcatgctttcgaagggcagctaaaaggagccgattcacgtattttagtggctcaagtg
cctggcggcatgctgaccaatatggaaagccaactcaaacagcaaaatgcacttgataaa
atagacgaagtgctgaaagagatccctcgcgtaagagaagatctcggttttattccactg
gttaccccaacgtcacaaatcgtaggcacgcaagcggtgatcaatgtgatgatgggtgag
cgttacaaaaccatcaccaaggaaacggctggtgttcttaaaggagaatacggacagaca
ccagcgccagtgaatgccgaacttcaagcgaaagtgctgaaaggcgcagcggcaatcact
tgtcgacctgctgatttaattgaaccagaaatcaatacgttgtcattgagtgttcaagca
caggccaaagagagaaatatctctttagttgaagaggtgattgacgatgttcttaccata
gcactgtttgaccaggtgggttggaagttcttagaaaatagaatgaatccagctgcattt
gagcctaagccttgtattgctgaggtgaaagcccccgttgtggcctgcaaagaagaacaa
gcgatctataccgtgagtgttaataaccaaagctacgttgttcaaatcaacgaaggcggt
gatccacaggttcttgcaactgcgtccaacgtttcccccaaagcagcggctgcttcggca
tcccctagtgctccttcaggtaacgctgaaacagtggctgctcctctggcaggcaacatt
tggaaaatacacaccaaggtaggagatgtagtcgaagaaggccaagtactgctgatttta
gaagccatgaaaatggaaacggaaatccgcgcagcccgggatggcattattgaaaagttg
agtgtctctgaaggggattccgtgcaggttggtgatgctttgatggcgttagcgtaa

DBGET integrated database retrieval system