KEGG   Vibrio anguillarum NB10: VANGNB10_cI2345cHelp
Entry
VANGNB10_cI2345c  CDS       T03657                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal subunit protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
vau  Vibrio anguillarum NB10
Pathway
vau03010  Ribosome
Brite
KEGG Orthology (KO) [BR:vau00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    VANGNB10_cI2345c (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:vau03011]
    VANGNB10_cI2345c (rplV)
Ribosome [BR:vau03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    VANGNB10_cI2345c (rplV)
  Bacteria
    VANGNB10_cI2345c (rplV)
  Archaea
    VANGNB10_cI2345c (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CDQ51257
UniProt: A0A191W6J7
Position
1:complement(2706558..2706890)
Genome map
AA seq 110 aa AA seqDB search
MEAIAKHNFARISPQKARLVADLIRGKSVDQALEILTFSNKKAAVLVKKVLESAIANAEH
NEGADIDDLNVAKIFVDEGPVMKRIMPRAKGRADRILKRSSHITVVVADR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagctattgctaaacataactttgctcgcatttctcctcagaaagctcgcttagtt
gcagatctaatccgtggtaaatctgtggatcaggctcttgaaatcctaactttcagcaac
aaaaaagcggctgtattagttaagaaagttctagagtcagctatcgctaacgcagaacac
aacgaaggtgcagatatcgacgatcttaatgtcgctaaaatcttcgtagatgagggcccg
gtcatgaagcgtattatgcctcgtgcaaaaggccgtgcggatcgtatcttgaagcgttca
agccacatcactgttgttgtagcagaccgctaa

DBGET integrated database retrieval system