KEGG   Vibrio anguillarum NB10: VANGNB10_cII0029Help
Entry
VANGNB10_cII0029  CDS       T03657                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
vau  Vibrio anguillarum NB10
Pathway
vau00051  Fructose and mannose metabolism
vau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VANGNB10_cII0029 (mtlD)
Enzymes [BR:vau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     VANGNB10_cII0029 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UPF0052 Sacchrp_dh_NADP DotD ApbA
Motif
Other DBs
NCBI-ProteinID: CDQ47926
UniProt: A0A241NK60
Position
2:27383..28531
Genome map
AA seq 382 aa AA seqDB search
MKNAVHFGAGNIGRGFIGKLLADADIEVTFADVNEPLVDQLSHRQEYKVKVVGSECKIDT
VTHVTAVNSASNDVIDRIVKTDLVTTAVGPAVLDIIAKTIAKGITKRFETGNEQPLNVIA
CENMVRGTTHLKGEVYKYLDPSLHAKTDELIGFVDSAVDRIVPPVEAANDDPLAVTVESF
SEWIVDEQQFKGEIPNIEGMEKTNNLMAFVERKLFTLNTGHCITAYLGCLSGHKTIREAI
EDPAIRQQVKQAMHESGEVLIRRYGFDRELHAAYIEKILSRFANPYLVDEVDRVGRQPIR
KLGPNDRLIKPLLGTIEYGVENKMLLKGIAAALKYTNDSDPQAVELQTSLNQYGVCKTLA
HYTGLDEQSEQVKQIEAIYKQL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgcagtacattttggcgcgggtaacattggtcgtggttttattggtaaatta
ttggccgatgcagacattgaagtgacttttgccgatgtcaatgaacctttggtcgatcaa
ttgagtcatcgtcaagaatacaaagtaaaggtagtcggttctgagtgcaaaattgatact
gtcactcatgtcactgcggtgaattcagccagtaatgatgtgattgatcgcattgtaaaa
acggatttagtcactacagctgtcggccctgcagtgcttgatatcattgcgaaaacgatc
gccaaaggcatcaccaaaagatttgaaacgggcaatgagcagccactcaatgtgatcgct
tgtgaaaacatggtgcgcggtacaacacacctgaaaggcgaagtgtataaatatctagac
ccatcgctgcatgctaaaaccgatgagttaattggttttgtcgattccgcggtggatcgc
attgtgccacctgtcgaagccgcgaacgatgacccgttggccgtgacggttgaaagtttc
agcgaatggattgttgatgaacagcaatttaaaggtgagatccccaacattgaagggatg
gaaaaaaccaataatctgatggcttttgttgagcgtaaacttttcactctaaatactggg
cactgcattaccgcctatttgggttgtttgagtggtcataagacgattcgtgaagcaatt
gaagatcctgcaattcgtcagcaagtgaagcaagccatgcacgaaagcggtgaagtactc
attcgtcgttacggttttgaccgtgaattgcacgccgcttatatcgaaaaaatattgagc
cgctttgccaacccatatttggtggatgaagtggatcgcgttggtcgtcagccaatacga
aaattaggccccaatgatagattaatcaagccattactcggtacaatcgagtacggtgtt
gaaaacaaaatgctattgaaagggattgcggcggcccttaagtataccaacgacagcgat
cctcaagcggtcgagcttcaaacatcattgaaccaatatggcgtatgtaaaacactggcc
cattacacagggttagatgagcagagcgagcaggttaagcaaattgaagcgatctacaaa
cagctttaa

DBGET integrated database retrieval system