KEGG   Vibrio anguillarum NB10: VANGNB10_cII0548Help
Entry
VANGNB10_cII0548  CDS       T03657                                 

Gene name
fhs
Definition
(GenBank) formate-tetrahydrofolate ligase (formyltetrahydrofolate synthetase)
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
vau  Vibrio anguillarum NB10
Pathway
vau00670  One carbon pool by folate
vau01100  Metabolic pathways
vau01120  Microbial metabolism in diverse environments
vau01200  Carbon metabolism
Module
vau_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:vau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    VANGNB10_cII0548 (fhs)
Enzymes [BR:vau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     VANGNB10_cII0548 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: CDQ48445
UniProt: A0A241NLQ1
Position
2:605257..607005
Genome map
AA seq 582 aa AA seqDB search
MLPDIEICRATSLTSIEAIANKAGFTASEFHSQGRFKAKISLSCLERLQTQTVGKLILVT
AITPTPLGEGKTVTTIGLSQGMAKLGHSVMACIRQPSMGPIFGVKGGAAGGGYSQVAPME
ELNLHLTGDIHAVTAAHNLAAAAIDARIYHEQRLGYDDFEQRTAMKALRIDPNNVVWKRV
MDHNDRALRMVTVGRNETDKSINGFEREDGFDISAASELMAILALAKNLNDLRQRIGRIV
VAYSHHGTPITTEDLQVAGAMAVSMKEAIEPTLMQTLEGVPTLIHAGPFANIAHGNSSII
ADDIATRLAEFTVTEGGFGSDMGFEKACNIKAATSGKAPDCAVIVTTLRGLKANSGLYEL
RPGQPVPDTLFQPGHAALVSGFENLKWHIENVSKYGIPAVVAINRFPQDSQEELEQLAMM
IHALPYQVEVALSEGFALGGEGTTELASKVIKQCEKVSTFTPLYQAQQKIEDKINAVAKK
GYGAASVTFTDKARRQMHNMQEQGYGKLAVCLAKTPLSISTNAAIKGAPKGFDVPIRELK
LCAGAGFIYALCGNVMTMPGLPEKPAFMYLDIDSKGNIIGLT
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctgatattgaaatttgccgcgccacttcattaacctccatagaggctatcgct
aacaaagcaggattcaccgccagcgaattccacagccaaggccgctttaaggcgaaaatt
tcattaagttgccttgaacgtttgcaaacacaaacggttggaaagttaatccttgtgact
gccattactccaacgccattaggggaaggaaaaaccgtcacgaccatcggcctatcacaa
ggaatggcaaaattgggtcattcggtgatggcatgtattcgtcaaccctcaatgggacca
atctttggtgttaagggcggagccgctggcggcggttattcacaagtggcaccaatggaa
gagctcaatttgcatctcactggcgatatccacgccgtcacagccgcgcataacctagcg
gcagcggcgatagatgcccggatctatcacgaacagcgccttggttatgacgatttcgag
cagcgcaccgcaatgaaagcactgcgtatcgacccaaataatgtggtttggaagcgagtg
atggatcacaacgatcgcgcattgcgcatggttaccgttggccgaaatgaaacggataaa
tcaatcaatggctttgagcgtgaagatggttttgatatttcagcggcttctgagctgatg
gcgattcttgcattagccaaaaacttaaacgatctgcgtcaacggattgggcggattgtc
gtcgcctatagtcaccatggtacaccgattaccaccgaagatttacaagtcgctggggcg
atggctgtcagtatgaaagaggcgattgaacctacattaatgcaaacgttagaaggcgta
ccgacactgattcacgccgggccttttgccaatatcgcgcacggtaactcttctattatc
gctgatgacatcgccacaaggttagccgaatttactgtaacagaaggcggctttggctct
gatatgggatttgaaaaggcgtgcaatattaaagcagcgacatctgggaaagcgccagat
tgcgccgttatcgtcaccacacttcgcggcttaaaagcgaactctggtctgtatgaattg
cgtcccggccagccagttcccgacactctatttcagccaggccatgccgcgttggtgtca
ggttttgaaaatctcaaatggcatattgaaaatgtgagtaagtatggaatacccgccgtg
gttgccattaaccgctttccacaagacagccaagaagagcttgagcagctcgcaatgatg
attcacgcactaccctaccaggtagaggttgcactgagtgaaggttttgctcttggaggc
gaagggacgactgagcttgcttccaaagtcattaagcagtgtgaaaaagtgagtacgttc
acaccgttataccaagcacagcagaagatcgaagataagatcaacgccgtagcgaaaaag
ggctatggcgcggcaagcgtcacttttactgataaagcacgacgtcaaatgcacaacatg
caagagcaaggttacgggaagcttgctgtctgtttggcgaagacgccgctttcaatttca
accaacgctgcgattaaaggcgcaccaaaaggttttgatgtaccgatccgcgaattaaag
ctctgtgcgggtgctggctttatctatgcgctatgcggcaacgtgatgaccatgccgggt
cttcctgaaaaacccgccttcatgtatttagacattgattctaaaggaaatattatcggc
ctaacctga

DBGET integrated database retrieval system