KEGG   Verrucomicrobia bacterium IMCC26134: IMCC26134_04100Help
Entry
IMCC26134_04100   CDS       T03830                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
vba  Verrucomicrobia bacterium IMCC26134
Pathway
vba00860  Porphyrin and chlorophyll metabolism
vba01100  Metabolic pathways
vba01110  Biosynthesis of secondary metabolites
vba01120  Microbial metabolism in diverse environments
Module
vba_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:vba00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    IMCC26134_04100
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vba01007]
    IMCC26134_04100
Enzymes [BR:vba01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     IMCC26134_04100
Amino acid related enzymes [BR:vba01007]
 Aminotransferase (transaminase)
  Class III
   IMCC26134_04100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AKC82167
UniProt: A0A0E3YVX9
Position
complement(1112010..1113296)
Genome map
AA seq 428 aa AA seqDB search
MSSPSSSEQLFARAQQLIPGGVNSPVRAFRSVGGAPFFTRSAQGATLTTVDGRELIDFVC
TWGPAIHGHNHPRIKAAIADALERGTSFGTPNPYEVEMAELIISFFPSIQKVRMCSSGTE
ATMSAIRLARGFTKRDKIIKFAGCYHGHSDSLLVSAGSGALTHGHPDSAGVPAAFARETV
VLPYNDTAAFDAAFDANPGQIAAVILEPYIGNVGFIRAEPGYLQHVRAATARAGTVLIFD
EVMTGFRLARGGVQELENIVPDLTCLGKIIGGGLPVGAFGGRAEIMDYLAPLGPVYQAGT
LSGNPLALAAGIAQLRLLDEVNPYARLDALGRQVCAAAAAAAAAKGLPLQTPQCGSMLSL
FFNPSPVRNMPDALASDAKLFGRFFRACLDGGVYLPPSAYEAWFLSTAHEGPAIERACEV
ITTAISGL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctccttcttcctccgaacaactcttcgcccgcgcccagcaactcattccgggc
ggggtcaactctccggtccgtgccttccgctcagtcggaggcgcgccatttttcacccgc
tccgcgcagggggccacgctcaccaccgtggacggtcgggaactcatcgactttgtctgc
acctggggtcccgccatccacgggcacaaccacccccgcatcaaggccgccatcgccgac
gccctcgaacgcggcacctctttcggaacgcccaacccttatgaggtcgaaatggccgag
ctcatcatctccttcttcccctccatccagaaggtccggatgtgctccagcggcaccgag
gccaccatgtccgccatccgcctcgcccgcggcttcaccaagcgcgacaagatcatcaag
ttcgccggctgctaccatgggcactcggattccctgctcgtgtccgccggctccggcgcg
ctcacgcatgggcaccccgacagcgcaggcgtgcctgctgccttcgcccgcgagaccgtg
gtcctgccttacaacgataccgccgccttcgacgccgccttcgacgccaaccccggccaa
atcgccgccgtcatcctggagccctacatcggcaacgtcggttttatccgcgccgagcca
ggctacctccagcacgtccgcgctgccaccgcccgcgccggcaccgtgctcatttttgac
gaagtcatgaccggcttccgcctcgcccgcggcggtgtgcaggagctggagaacatcgtt
cccgacctcacctgcctcggtaaaatcatcggcggcggcctgcccgtcggggccttcggc
ggacgcgccgagatcatggattacctcgccccgctcggccctgtttaccaggcgggcacg
ctgtcgggtaacccgctcgccctcgccgccggcatcgcccagctccgcctgctcgacgag
gtcaacccctacgcccggctcgacgccctcggccgccaagtctgcgccgccgccgccgcc
gccgccgccgcgaagggcctgccactgcaaaccccgcagtgcggctccatgctcagcctc
ttcttcaatcccagccccgtgcgcaatatgcctgacgcgctggcatccgacgcaaaactc
ttcggacgcttcttccgcgcctgtctcgacggcggggtgtatctgccgccgagcgcttac
gaagcctggttcctcagcaccgcccacgaaggccccgctatcgaacgcgcctgcgaagtc
atcacgactgccatttcgggactctag

DBGET integrated database retrieval system