KEGG   Victivallales bacterium CCUG 44730: C5Q97_08670Help
Entry
C5Q97_08670       CDS       T05502                                 

Definition
(GenBank) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
vbc  Victivallales bacterium CCUG 44730
Pathway
vbc00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:vbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    C5Q97_08670
Enzymes [BR:vbc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     C5Q97_08670
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     C5Q97_08670
    1.1.1.-  
     C5Q97_08670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AVM44778
UniProt: A0A2S0KUU8
Position
2114292..2115284
Genome map
AA seq 330 aa AA seqDB search
MKSAFHTGVKEITIRETPVPTPGPGEYLVRIKACAICGSDTWWASPASDTEPVHGHESAG
VIEACGPGATRYKVGDRVVCYAIRGCGSCENCRNGIPTRCASSQFVEGGFQEYSLFTADL
LFPCPERIDFVTASLLSDAIGVPLRGLRRLPPAPTDSVTVWGLGPLGLLQVLFLRARGVK
QIIGLDTVEARRKKALELGADFVLDPAGCDVVAEVEKLCGGDGADKAYTFVRNAQATETA
VRSTKKGAGICTFVGLEGNFNLPEWLERTMVWSFYFTPDEYADNVRFLQEHRIDLRQVVS
DVFPLDRIGEAFAKRFADREHSTKIVITMD
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcgcattccacaccggcgtaaaagagatcacgatccgcgagaccccggtgccg
acgccgggtcctggcgaatacctcgtcaggatcaaagcctgcgccatctgcggctcggac
acctggtgggccagcccggcctcggacacggagccggtgcacggccacgagtcggccggc
gtcatcgaagcctgcggccccggagcgacccggtacaaggtcggcgaccgggtcgtctgc
tacgcaatccgcggctgcggcagctgcgaaaactgccggaacgggattccgacccgctgc
gcgtcgagtcagttcgtcgaagggggctttcaggagtattcgctcttcacggccgatctg
ctctttccgtgtccggagaggattgacttcgtcacggcgtcgctgctgtcggatgcgatc
ggagtaccgctgcgcgggctccggcggctgccgcccgcaccgaccgattcggtcacggtc
tgggggctcggcccgctcgggctgctgcaggtgctcttcctgcgggcccgtggagtgaaa
cagatcatcgggctcgacacggtcgaggcgcggcggaagaaggcgctcgaactcggcgcg
gacttcgtgctcgaccccgccggctgcgacgtggttgccgaagttgaaaagctctgcggc
ggcgacggggccgacaaggcctacaccttcgtgcggaacgcgcaggcgaccgagacggcc
gtcaggagcacgaagaaaggcgccggaatctgcaccttcgtcgggctcgaaggaaacttc
aacctgccggagtggctcgaacggacgatggtctggtcgttctacttcacgccggacgag
tatgccgacaacgtccgtttcctgcaggagcaccggatcgacctcaggcaggtcgtctcc
gacgtattcccgcttgaccggatcggcgaggctttcgcaaaacgcttcgcggaccgggag
cattcgacgaagatcgtcattacaatggattga

DBGET integrated database retrieval system