KEGG   Victivallales bacterium CCUG 44730: C5Q97_08990Help
Entry
C5Q97_08990       CDS       T05502                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
vbc  Victivallales bacterium CCUG 44730
Pathway
vbc00220  Arginine biosynthesis
vbc01100  Metabolic pathways
vbc01110  Biosynthesis of secondary metabolites
vbc01130  Biosynthesis of antibiotics
vbc01230  Biosynthesis of amino acids
Module
vbc_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:vbc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    C5Q97_08990 (argF)
Enzymes [BR:vbc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     C5Q97_08990 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AVM44839
UniProt: A0A2S0KV21
Position
2193586..2194488
Genome map
AA seq 300 aa AA seqDB search
MKKDLLTLRDITRNDLEHIFELASKLKAERGKTAFTPLAGKSVGLIFAKSSTRTRVSFEV
GVGELGGRPLYLDQSKMQIGRGETVADTAKVLSRYLHGIVIRTFSHAEVEELAREADIPV
INALTDEYHPCQILADLLTIREYSGRTDGSIRMAFYGDARSNIANSLILAARLTGMELVL
CSPAEEQPDQALYAGCSNVSWEADPMKAAAGVDYFYTDVWVSMGFEEERERRMKLFAPYQ
VNEKLFSVAKPDAKFLHCLPAHRGEEVSAGVMDDPKRSIVFDEAENRLHVQKAVMAMLMK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggaccttttgacgctccgggacatcacccggaacgatctggaacatattttc
gaactcgcgtcgaagctcaaggccgaacgcggcaaaaccgcgttcacgccgctggccggc
aagagcgtcgggctgattttcgcgaaatcctcgacccggacccgggtctcgttcgaagtc
ggcgtcggcgagctcggcggccgcccgctctatctcgatcagagcaagatgcagatcggc
cgcggcgagacggtggcggacacggccaaagtgctgagccgttacctgcacggcatcgtg
atccggaccttctcacacgccgaagtcgaagagctggcgcgcgaagcggacattccggtc
atcaatgcgctgaccgacgaataccatccgtgccagattctggccgacttgctcaccatc
cgggagtattccgggcggaccgacgggtcgatcagaatggcgttctacggcgacgcgcgc
agcaacatcgcgaattcgctgatcctcgccgcgcggctgaccggcatggagcttgtgctc
tgctccccggcggaggagcagcccgaccaagcgctctacgccggatgctccaacgtgagc
tgggaggcggacccgatgaaggccgccgccggtgtcgactatttctacaccgacgtctgg
gtcagcatgggcttcgaggaggagcgcgagcggcgcatgaagctcttcgccccgtaccag
gtcaacgagaagctgttctccgtcgcgaagccggatgcgaagttcctgcactgcctgccc
gcccatcgcggcgaggaggtttcggccggcgtaatggatgatccgaagcggtcgatcgtc
ttcgacgaggcggaaaaccgtctccacgttcaaaaagccgtcatggcgatgctgatgaaa
taa

DBGET integrated database retrieval system