KEGG   Victivallales bacterium CCUG 44730: C5Q97_19690Help
Entry
C5Q97_19690       CDS       T05502                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
vbc  Victivallales bacterium CCUG 44730
Pathway
vbc00520  Amino sugar and nucleotide sugar metabolism
vbc01100  Metabolic pathways
vbc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C5Q97_19690
Enzymes [BR:vbc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     C5Q97_19690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DRTGG
Motif
Other DBs
NCBI-ProteinID: AVM46816
UniProt: A0A2S0L0J2
Position
4812998..4813912
Genome map
AA seq 304 aa AA seqDB search
MRNPGWIDLQVNGCSGIDFSSPELTGDDFLRAAERVLESGTGCFLPTLITSPFGLYRRNL
GVIRRAVVRHGLEREVPGVHLEGPFISADPGAAGAHNPDWVVPPDPEKVEALLDLEPGFV
RLVTLGADAENAAGAVRLLRSRGVAVSVGHHLADSGEIAAAADAGAQALTHLGNGVPGMV
PRHRNPIWAGLAEERLSAMIITDGHHLPPELIRVICKVKGAAKIIVTSDASPGAGLPPGP
CRVFGSDAILEPGGRLYNPATGYLAGSAVMLAECMRRLESLGIFSEAELRMAGRDNALKL
IGPA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatccgggctggatcgatcttcaggtcaacggctgttccggcatcgatttttcg
agtccggagctgaccggggacgactttctgcgcgcggcggagcgggtgctcgaaagcggc
accgggtgttttctgccgacgctgatcacgagcccgttcggcctctaccgccgcaacctc
ggcgtgatccggcgggcggtcgtccggcacgggctggagcgggaagtgccgggcgttcat
ctcgaaggaccgttcatttccgccgatcccggcgcggccggggcgcacaacccggactgg
gtcgtgccgccggatcccgaaaaagtcgaagcgctgctcgatctggagccgggtttcgtg
aggctcgtcacgctcggggccgatgcggagaacgcggccggcgcggttcgccttctgcgt
tcgcgcggagtggccgtgtcggtcgggcaccacctggcggattccggtgaaatcgccgcc
gccgccgatgccggggcgcaggcgctgacccacctcggcaacggcgtgccgggcatggtt
ccgcgccaccggaatccgatctgggccggactggccgaggagaggctttcggccatgatc
atcaccgacggtcaccatctgccgccggaactgatccgggtgatctgcaaagtcaagggc
gccgcgaagatcatcgtcacgagcgacgcatcgccgggggcggggctgccgccggggccg
tgccgcgtgttcggcagcgatgcgattctcgaaccgggcggacggctttacaatccggcg
accggctatctcgccgggtcggcggtcatgctggcggagtgcatgcgccgcctcgaatcc
ctcggcattttcagtgaggcggagctccgcatggccgggcgcgacaatgcgctgaagctg
atcgggccggcatag

DBGET integrated database retrieval system