KEGG   Nibricoccus aquaticus HZ-65: CMV30_00350Help
Entry
CMV30_00350       CDS       T05426                                 

Definition
(GenBank) permease
  KO
K07091  lipopolysaccharide export system permease protein
Organism
vbh  Nibricoccus aquaticus HZ-65
Pathway
vbh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CMV30_00350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vbh02000]
    CMV30_00350
Transporters [BR:vbh02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    CMV30_00350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LptF_LptG
Motif
Other DBs
NCBI-ProteinID: ATC62550
UniProt: A0A290Q5V4
Position
complement(79138..80319)
Genome map
AA seq 393 aa AA seqDB search
MLSARVRAARCGGILGLLDRHIFKNVLFTCLGAVGFFTFIMMAANALKDLVGYFLSGRLS
PGTMAELLFWLMPYAVMYALPMGILCGVLLVLGRMSAESEITAMRAAGLGLWRIARPIYV
LGATGLVCGLFVNLQFMPVARVKYKQELLNAVRTDPKALLVPKTFVREFKRMVVYVGERQ
GDIVKDVWVWRLDAESRVISCLKAESGRISFDDTDNSLVFTAQNAILETRDDKMPESFTE
MPTTAPYESSSLKFPLEKLFGQQVINRKPDWLTFPVLLGEIERLKQPVVGGDEVARVQAL
TKHRIVLQDKLAKAVAVLAFVFIAVPLGIKVSRRETSANLVVAVALALAYYFLTEAAKWL
EAYPQARPDLLLWLPNLIFVYLGLRWMKRVQSA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
ctgttgtcagcgcgggtccgggctgcacgatgcggcggcatcttgggactgctcgaccgt
catattttcaaaaacgtgctcttcacgtgtctgggcgcggtggggttcttcacgttcatc
atgatggcggcgaacgcgctgaaggatctggtcgggtattttctgtcggggcggctttcc
ccggggacgatggcagagctgttgttctggttgatgccgtacgcggtgatgtacgcgctg
ccgatggggattttgtgcggcgtgctgctggtgctggggcggatgtcggccgagagcgag
attacggcgatgcgcgcggcggggctcgggctttggcggatcgcgcggccgatttatgtg
ctgggtgcgacggggctggtgtgcgggctttttgtgaacttgcagttcatgccggtggcg
cgggtgaagtataaacaggagctgctgaatgcggtgaggaccgatccgaaggcgttgctg
gtgccgaagacatttgtccgggagtttaagcggatggttgtttatgtcggtgagcggcag
ggggacatcgtgaaggatgtgtgggtgtggcggcttgacgcagagtcgcgggtgatcagc
tgcctgaaggcggagagcgggcgcatcagcttcgacgatacggacaacagtctggtgttc
acggcgcagaacgcgattttggagacgcgggatgacaagatgccggagagtttcacggag
atgccgacgacggcgccttacgagagttcgagcctgaagtttccgctggagaaattattc
gggcagcaggtgatcaaccgaaagccggactggctgacgtttccggttttgctgggtgag
atcgagcggttgaagcagccggtcgtcgggggcgacgaggtggcgcgggtgcaggcgctg
acgaagcatcggatcgtgctgcaggacaaactggcgaaggcggtggcggtgctggcgttc
gtgtttatcgcggtgccgctggggatcaaagtttcgcggcgcgagacgtcggcgaatctg
gtcgtggccgtggcgctggcgctggcgtattattttctgacggaggcggcgaagtggctg
gaggcttatccacaggcgcggccggatttgctgctgtggttgcctaatttgattttcgtg
tacctcgggttgcggtggatgaagcgggtgcaaagcgcgtga

DBGET integrated database retrieval system