KEGG   Nibricoccus aquaticus HZ-65: CMV30_00385Help
Entry
CMV30_00385       CDS       T05426                                 

Definition
(GenBank) nitrate ABC transporter ATP-binding protein
  KO
K15578  nitrate/nitrite transport system ATP-binding protein [EC:3.6.3.-]
Organism
vbh  Nibricoccus aquaticus HZ-65
Pathway
vbh00910  Nitrogen metabolism
vbh02010  ABC transporters
Module
vbh_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:vbh00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    CMV30_00385
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CMV30_00385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vbh02000]
    CMV30_00385
Enzymes [BR:vbh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     CMV30_00385
Transporters [BR:vbh02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter
    CMV30_00385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran RsgA_GTPase MMR_HSR1 AAA_16 AAA_29 AAA_23 AAA_30 AAA AAA_22 AAA_18 AAA_25 Dynamin_N IIGP
Motif
Other DBs
NCBI-ProteinID: ATC62556
UniProt: A0A290Q8K2
Position
86216..87124
Genome map
AA seq 302 aa AA seqDB search
MSFLEIKNASKSYLNGGKRSEVLTDINLDIAEGEFVAIVGYSGAGKSTLINFLSGLVKSD
TGTVTLEGKPITGPGPDRGLIFQNYSLLPWLTVFENIALAVDEIFHDWSADKRREHIDRY
IAMVKLTRARDKKPHELSGGMRQRVSVARTLAMNPRILLMDEPFGALDALTRGDLQQETL
QIWEEDKRTVVLITNDPDEAILMADRVIPLTAGPRATLGPSIPITLPRPRRRAELNENYD
FKQIRAEVTDYLLKATDRRKGGVTKSLILPDIEPEDLNTKQTIIGKRRPIRRSEIKQETV
ES
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttctcgaaatcaaaaacgcttcgaagtcgtatctcaacggcggcaagcgctcc
gaggtcttaaccgacatcaacctcgacatcgccgagggtgaattcgtcgccatcgtcggc
tactccggcgcaggcaaaagcacgctcatcaacttcctctccggtctcgtgaaatccgat
accggcaccgtcacgcttgagggaaagcccatcaccggccccggtcccgaccgtggcctc
atcttccaaaactactcgctgctcccctggctcaccgtcttcgaaaacatcgccctcgcc
gtcgacgaaatctttcacgactggtccgccgataaacgccgcgaacacatcgatcgctac
atcgccatggtgaagctcactcgcgcgcgtgacaaaaaacctcacgagctttccggcggt
atgcgccagcgcgtcagcgtcgcccggaccctcgcgatgaatccgcgaatcctcctcatg
gacgagccattcggcgcgctcgacgccctcacccgcggcgatcttcagcaggagacgctc
cagatctgggaggaagacaaacgcaccgtcgtcctcatcaccaacgatcccgacgaagcc
atcctcatggccgaccgcgtcatcccgctcaccgccggaccccgcgccaccctcggacca
agcatcccgatcacacttccccgcccgcgccgccgcgccgagctcaacgaaaattacgac
ttcaaacagatccgcgccgaggtcaccgactacctcctcaaagccaccgaccgccgcaaa
ggcggcgtcaccaaatccctcatccttcccgacatcgagcccgaggatctcaacacgaag
caaaccatcatcggcaaacgccgcccgatccgccgcagcgaaatcaaacaggagaccgtt
gaatcatga

DBGET integrated database retrieval system